CAZyme Information: MGYG000002592_00345

Basic Information

• Species: Alistipes sp902388705
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Rikenellaceae; Alistipes; Alistipes sp902388705
• CAZyme ID: MGYG000002592_00345
• CAZy Family: GH26
• CAZyme Description: Mannan endo-1,4-beta-mannosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
378	MGYG000002592_3|CGC1	43516.24	6.5664

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002592	2965227	MAG	China	Asia

• Gene Location: Start: 35270; End: 36406 Strand: -

Full Sequence      

MLRILVSFMAASLLGGCISDNPKIAPVNPDASQQARQLLEFLYSVRGRYTLAGQHNFISD
PGRYDSVVFAMTGKRPVVWGSDFSFNAQGGNVRDYHHCGPMNLTSPWGECLPNNKSTEEL
RQGLVEEIKARHAEGRIITLMWHCCFPAECNDCNGSSIWTWKNRPPQRVWEELTTDGTRL
NLQWKAQMNTIIPYLKQLRDARIPILWRPYHEMNGVWFWWCAKPGENGFKKLWIMTYDYL
TRVHGLDNLLWVWNTNAPRDKEGDEAGPYADYYPGSEYVDILAADVYHRDYKQSHHDELK
ALAGGKLIALGEVGQLPEPESYHNQPDWAWFMVWGYFINSQKSGELDSAAAVRRIYDDPR
TLTLDRIDFSDGTYRLLK

Enzyme Prediction     

No EC number prediction in MGYG000002592_00345.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH26	27	365	1.4e-77	0.9933993399339934

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam02156	Glyco_hydro_26	3.62e-46	27	365	1	310	Glycosyl hydrolase family 26.
COG4124	ManB2	2.02e-17	203	287	180	256	Beta-mannanase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBL01059.1	1.92e-285	1	376	1	376
BBL06294.1	9.12e-245	1	376	1	376
ALI98661.1	7.43e-102	4	367	5	328
AHM62992.1	3.13e-98	26	368	24	330
QEM10555.1	1.79e-95	26	367	24	329

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6Q75_A	1.75e-93	16	371	13	331	Thestructure of GH26A from Muricauda sp. MAR_2010_75 [Muricauda sp. MAR_2010_75],6Q75_B The structure of GH26A from Muricauda sp. MAR_2010_75 [Muricauda sp. MAR_2010_75]
3ZM8_A	1.73e-38	28	367	147	447	ChainA, Gh26 Endo-beta-1,4-mannanase [Podospora anserina S mat+]
6HPF_A	8.19e-38	22	368	2	311	Structureof Inactive E165Q mutant of fungal non-CBM carrying GH26 endo-b-mannanase from Yunnania penicillata in complex with alpha-62-61-di-galactosyl-mannotriose [Yunnania penicillata]
3WDQ_A	2.07e-32	21	367	29	352	Crystalstructure of beta-mannanase from a symbiotic protist of the termite Reticulitermes speratus [Symbiotic protist of Reticulitermes speratus],3WDR_A Crystal structure of beta-mannanase from a symbiotic protist of the termite Reticulitermes speratus complexed with gluco-manno-oligosaccharide [Symbiotic protist of Reticulitermes speratus]
6HF2_A	1.11e-27	5	334	8	314	Thestructure of BoMan26B, a GH26 beta-mannanase from Bacteroides ovatus [Bacteroides ovatus ATCC 8483],6HF4_A The structure of BoMan26B, a GH26 beta-mannanase from Bacteroides ovatus, complexed with G1M4 [Bacteroides ovatus ATCC 8483]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
G2Q4H7	2.17e-41	28	367	176	476	Mannan endo-1,4-beta-mannosidase OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=Man26A PE=1 SV=1
Q5AWB7	4.27e-36	3	367	5	350	Probable mannan endo-1,4-beta-mannosidase E OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=manE PE=3 SV=1
P49425	8.43e-32	9	367	117	457	Mannan endo-1,4-beta-mannosidase OS=Rhodothermus marinus (strain ATCC 43812 / DSM 4252 / R-10) OX=518766 GN=manA PE=1 SV=3
A2R6F5	2.69e-28	5	365	7	331	Mannan endo-1,4-beta-mannosidase man26A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=man26A PE=1 SV=1
O05512	1.45e-26	2	367	7	351	Mannan endo-1,4-beta-mannosidase OS=Bacillus subtilis (strain 168) OX=224308 GN=gmuG PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000000	1.000061	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002592_00345.