CAZyme Information: MGYG000002592_00346

Basic Information

• Species: Alistipes sp902388705
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Rikenellaceae; Alistipes; Alistipes sp902388705
• CAZyme ID: MGYG000002592_00346
• CAZy Family: GH26
• CAZyme Description: Mannan endo-1,4-beta-mannosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
377	MGYG000002592_3|CGC1	43014.21	7.766

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002592	2965227	MAG	China	Asia

• Gene Location: Start: 36413; End: 37546 Strand: -

Full Sequence      

MKRLLICLLLLPLCGAAFAGGKRLKAPEKTVLKMVDPQATPETKALYANLWCIGFRGVMF
GHHDYPSYGIGWRGDPDRSDVKDIVGSHPAVYSLDMAGINDQKIELLRKAHKRGGISMLV
WHQNNPLTEGPGKKYPDGTAWDNTKVVDRILTEGSPMNVKYKARLDDVAEALKKMVDDDG
RPIPVIFRPLHEHTQTWNWWGRSATTDSEFIAFWRFIVSYLRDTKGIHNVIYAISPQMDE
VYDDPVGRILFRWPGDEWVDLVGIDCYHGRNRKAFESNVKALAEVSKRVHKPVGVTETGL
ENNHNADYWTHDVLPMLRNRPCCMVVAWRNDNPRHAYGPYPSDSTAADFKLFYDDPWTVF
ENDLPDMYRMPKGVTVK

Enzyme Prediction     

No EC number prediction in MGYG000002592_00346.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH26	35	301	1.5e-58	0.834983498349835

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam02156	Glyco_hydro_26	3.74e-37	35	267	1	230	Glycosyl hydrolase family 26.
COG4124	ManB2	2.13e-10	160	299	159	296	Beta-mannanase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBL01058.1	2.25e-288	1	377	1	377
BBL06293.1	1.05e-241	1	377	1	379
ADF53787.1	7.87e-187	32	376	399	743
AGY53051.1	3.42e-128	59	376	1	323
BBL01052.1	1.07e-120	28	377	62	423

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2VX4_A	7.92e-72	27	369	26	396	CellvibrioJaponicus Mannanase Cjman26c Native Form [Cellvibrio japonicus],2VX6_A CELLVIBRIO JAPONICUS MANNANASE CJMAN26C Gal1Man4-BOUND FORM [Cellvibrio japonicus]
4CD4_A	1.48e-71	27	369	49	419	Thestructure of GH26 beta-mannanase CjMan26C from Cellvibrio japonicus in complex with ManIFG [Cellvibrio japonicus Ueda107],4CD5_A The structure of GH26 beta-mannanase CjMan26C from Cellvibrio japonicus in complex with ManMIm [Cellvibrio japonicus Ueda107]
4ZXO_A	2.54e-71	38	370	7	345	Thestructure of a GH26 beta-mannanase from Bacteroides ovatus, BoMan26A. [Bacteroides ovatus]
2VX5_A	6.21e-71	27	368	26	395	CellvibrioJaponicus Mannanase Cjman26c Mannose-Bound Form [Cellvibrio japonicus]
2VX7_A	6.21e-71	27	369	26	396	CellvibrioJaponicus Mannanase Cjman26c Mannobiose-Bound Form [Cellvibrio japonicus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P49424	2.04e-56	6	371	20	418	Mannan endo-1,4-beta-mannosidase OS=Cellvibrio japonicus (strain Ueda107) OX=498211 GN=manA PE=1 SV=2
A1A278	1.98e-32	17	354	26	388	Mannan endo-1,4-beta-mannosidase OS=Bifidobacterium adolescentis (strain ATCC 15703 / DSM 20083 / NCTC 11814 / E194a) OX=367928 GN=BAD_1030 PE=1 SV=1
O05512	3.83e-18	25	308	22	304	Mannan endo-1,4-beta-mannosidase OS=Bacillus subtilis (strain 168) OX=224308 GN=gmuG PE=1 SV=2
P49425	4.04e-18	27	299	139	408	Mannan endo-1,4-beta-mannosidase OS=Rhodothermus marinus (strain ATCC 43812 / DSM 4252 / R-10) OX=518766 GN=manA PE=1 SV=3
P16699	3.18e-14	36	268	36	271	Mannan endo-1,4-beta-mannosidase A and B OS=Caldalkalibacillus mannanilyticus (strain DSM 16130 / CIP 109019 / JCM 10596 / AM-001) OX=1236954 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000305	0.999022	0.000189	0.000167	0.000144	0.000137

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002592_00346.