CAZyme Information: MGYG000002593_00976

Basic Information

• Species: Limosilactobacillus sp900557215
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Lactobacillaceae; Limosilactobacillus; Limosilactobacillus sp900557215
• CAZyme ID: MGYG000002593_00976
• CAZy Family: GH25
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
404		45155.43	9.1437

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002593	1475799	MAG	China	Asia

• Gene Location: Start: 45497; End: 46711 Strand: +

Full Sequence      

MRIKKCFKLALTFVVGAFLMGSFSSPAFASKGDQGVDWSKFQDAYGKWGSPDDKFSISQV
GGYYNGSFVDQWTYPTQVRNTIAMGRRAHTYIYAQFSGRWQADQMLNYYLPKVQTPRGSI
VMLDVESGNPDTDSVLYALKRVQDSGYTAVLYGYKNFLVNHLDLHKIASQYPLALAEYPD
YNVTKRPNYNFFPSFENIGIFQFTSTYVAGGLDGDVDLTGITDNGYKGGNALKPKTNTPA
VDAGKQIHRDTHNYTVKSGDSWWKIAHDHGMDMYALAKLNNQTINNAIYPGEVLRVADGG
DGTHVSNKVNQPVQQPTASSWTDGLGDTWHKESGTFTSTTWLHLRWGAKPNSATIAYVGP
GTTIKYDAWSKHDGFIYVRQPRSNGYGYIAVRNAWNHEPYGTFK

Enzyme Prediction     

EC	3.2.1.17

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH25	36	211	1.5e-27	0.9887005649717514

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06415	GH25_Cpl1-like	2.10e-52	33	219	1	196	Cpl-1 lysin (also known as Cpl-9 lysozyme / muramidase) is a bacterial cell wall endolysin encoded by the pneumococcal bacteriophage Cp-1, which cleaves the glycosidic N-acetylmuramoyl-(beta1,4)-N-acetylglucosamine bonds of the pneumococcal glycan chain, thus acting as an enzymatic antimicrobial agent (an enzybiotic) against streptococcal infections. Cpl-1 belongs to the CP family of lysozymes (CPL lysozymes) which includes the Cpl-7 lysin. Cpl-1 has a glycosyl hydrolase family 25 (GH25) catalytic domain with an irregular (beta/alpha)5-beta3 barrel and a C-terminal cell wall-anchoring module formed by six similar choline-binding repeats (ChBr's). The ChBr's facilitate the anchoring of Cpl-1 to the choline-containing teichoic acid of the pneumococcal cell wall. Other members of this domain family have an N-terminal CHAP (cysteine, histidine-dependent amidohydrolases/peptidases) domain similar to that of the firmicute CHAP lysins and associated with endopeptidase activity. The Cpl-7 lysin is also included here as is LysB of Lactococcus phage, and the Mur lysin of Lactobacillus phage.
smart00641	Glyco_25	9.33e-17	118	225	2	109	Glycosyl hydrolases family 25.
pfam01183	Glyco_hydro_25	3.07e-16	36	212	1	180	Glycosyl hydrolases family 25.
cd00118	LysM	1.16e-11	254	296	3	45	Lysin Motif is a small domain involved in binding peptidoglycan. LysM, a small globular domain with approximately 40 amino acids, is a widespread protein module involved in binding peptidoglycan in bacteria and chitin in eukaryotes. The domain was originally identified in enzymes that degrade bacterial cell walls, but proteins involved in many other biological functions also contain this domain. It has been reported that the LysM domain functions as a signal for specific plant-bacteria recognition in bacterial pathogenesis. Many of these enzymes are modular and are composed of catalytic units linked to one or several repeats of LysM domains. LysM domains are found in bacteria and eukaryotes.
smart00257	LysM	4.01e-11	254	296	2	44	Lysin motif.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QAR22460.1	1.03e-196	29	404	42	413
QFG73426.1	1.58e-175	29	404	21	396
QIZ05292.1	6.19e-174	29	404	14	392
QDK49467.1	2.73e-164	11	404	5	397
QLL70978.1	1.11e-151	14	404	1	408

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6AKV_A	7.26e-09	331	404	205	282	ChainA, LysB4 [Bacillus phage B4]
5A6S_A	6.19e-07	20	227	1	207	Crystalstructure of the CTP1L endolysin reveals how its activity is regulated by a secondary translation product [Clostridium phage phiCTP1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8HA43	2.50e-14	98	218	210	342	D-alanyl-L-alanine endopeptidase OS=Streptococcus phage B30 OX=209152 PE=1 SV=2
P39046	2.13e-06	254	299	338	382	Muramidase-2 OS=Enterococcus hirae (strain ATCC 9790 / DSM 20160 / JCM 8729 / LMG 6399 / NBRC 3181 / NCIMB 6459 / NCDO 1258 / NCTC 12367 / WDCM 00089 / R) OX=768486 GN=EHR_05900 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000260	0.998939	0.000270	0.000200	0.000174	0.000154

TMHMM  Annotations     

start	end
7	29