CAZyme Information: MGYG000002596_00777

Basic Information

• Species: Mediterraneibacter sp900555215
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Mediterraneibacter; Mediterraneibacter sp900555215
• CAZyme ID: MGYG000002596_00777
• CAZy Family: GH136
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
914	MGYG000002596_16|CGC1	99796.54	4.3274

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002596	2662706	MAG	China	Asia

• Gene Location: Start: 8064; End: 10808 Strand: +

Full Sequence      

MKSCNVIKNGDSTALFMVKNIIYDRKNIIIFENNCKKITMMIFLYGRYSDAPTFRDNGPF
GEEGSAVYLCNQEYWEINNLRVKNWSDDGQDKERSGIRIEAYGGGTYHHIYIKNCEISDI
RGYNGQDSIWDVKPENGGTTFYGSRTTHRTGGINVVSYTERDLTNATSSSTAGEVIDEKP
TVFDDILIEGNKIENCHANGTTTTNIRGELDDKDYRHTNVVIRENEIRNVQRAGIVPLYT
SEALVERNLVDTFQQTYAGYGCGIWCDRADGMVFQYNEVCNGKNTMDGMAFNLDDMTENG
IIQYNYTHNNVGGGIMLHVRTNSYNRNNTVRYNLSVNDTAGFAAHQAVIVCVGEDANTKI
EKAKVYNNTFVNNNVVHPVYQGDEILFENNIFYFPNEGMESRDDAYVTGANTSFRNNVFA
GAHSSSEPENAGKNSKNIYVDESPLAGTFYGTESLEDTKGMAKLVHGSAALEAGDPAVLE
GGPTKDFYGNASVNNGKINAGIYNGESVDLIPDKGDPGLEPDPGSDDEPSEEDYDVEYVE
AEDGRVKKSDGYSLVSGSESQGHGNTYIYYTATDTYVEYTFTGKAISVYTKTGPGAGTID
ILIDCEHVGVDDQYTAAQQFNKRAFTKVFDEEGTHTIRLENNGLKNPSATGNSFNIDCFK
VFKEKEAVKDSNADLASLSYVLNDGAPTAVEGFSAEKTSYEAALPAGTAGTVRLEGKAFS
DAASVKEEPVAIVDGKAEAVLTVTAEDGTTKEYKVAFTVEEPEPEPPAITITLKLNGAGE
DIFLQADENGHVTRPEDPVRAGYVFGGWYTDEACTEAFDFENAVVTEDLTLYAKWTKIDD
GEEEKPEDPGTPEKPGDVQKPGQADDSSKDVQTGKDAVTPKTGDNTQPPFGYAAAVIGAG
ILAAAAAKRRKTKI

Enzyme Prediction     

No EC number prediction in MGYG000002596_00777.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH136	35	498	1.1e-66	0.8615071283095723

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam09479	Flg_new	2.79e-13	770	834	2	65	Listeria-Bacteroides repeat domain (List_Bact_rpt). This model describes a conserved core region of about 43 residues, which occurs in at least two families of tandem repeats. These include 78-residue repeats which occur from 2 to 15 times in some proteins of Bacteroides forsythus ATCC 43037, and 70-residue repeats found in families of internalins of Listeria species. Single copies are found in proteins of Fibrobacter succinogenes, Geobacter sulfurreducens, and a few other bacteria.
TIGR02543	List_Bact_rpt	1.46e-07	798	838	1	42	Listeria/Bacterioides repeat. This model describes a conserved core region, about 43 residues in length, of at least two families of tandem repeats. These include 78-residue repeats from 2 to 15 in number, in some proteins of Bacteroides forsythus ATCC 43037, and 70-residue repeats in families of internalins of Listeria species. Single copies are found in proteins of Fibrobacter succinogenes, Geobacter sulfurreducens, and a few bacteria. [Unknown function, General]
NF033188	internalin_H	2.67e-06	795	889	439	526	InlH/InlC2 family class 1 internalin. Internalins, as found in the intracellular human pathogen Listeria monocytogenes, are paralogous surface or secreted proteins with an N-terminal signal peptide, leucine-rich repeats, and usually a C-terminal LPXTG processing and cell surface anchoring site. See PMID:17764999 for a general discussion of internalins. Members of this family are internalin H (InlH), or internalin C2, two class 1 (LPXTG-type) internalins that are closely related, one apparently derived from the other through a recombination event.
NF033189	internalin_A	5.02e-05	787	885	653	772	class 1 internalin InlA. Internalins, as found in the intracellular human pathogen Listeria monocytogenes, are paralogous surface or secreted proteins with an N-terminal signal peptide, leucine-rich repeats, and usually a C-terminal LPXTG processing and cell surface anchoring site. See PMID:17764999 for a general discussion of internalins. Members of this family are internalin A (InlA), a class 1 (LPXTG-type) internalin.
NF033188	internalin_H	0.002	749	836	325	411	InlH/InlC2 family class 1 internalin. Internalins, as found in the intracellular human pathogen Listeria monocytogenes, are paralogous surface or secreted proteins with an N-terminal signal peptide, leucine-rich repeats, and usually a C-terminal LPXTG processing and cell surface anchoring site. See PMID:17764999 for a general discussion of internalins. Members of this family are internalin H (InlH), or internalin C2, two class 1 (LPXTG-type) internalins that are closely related, one apparently derived from the other through a recombination event.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AYE35145.1	8.83e-143	64	685	140	770
AZG68471.1	1.52e-96	64	397	218	560
QNK55088.1	6.49e-43	67	509	144	544
QJD84649.1	8.57e-43	67	508	341	739
QNK55089.1	1.60e-41	61	508	334	740

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6KQT_A	8.17e-15	45	341	333	620	CrystalStructure of GH136 lacto-N-biosidase from Eubacterium ramulus - native protein [Eubacterium ramulus ATCC 29099]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P0DJ98	8.93e-10	770	835	84	149	Putative membrane protein Bcell_0381 OS=Evansella cellulosilytica (strain ATCC 21833 / DSM 2522 / FERM P-1141 / JCM 9156 / N-4) OX=649639 GN=Bcell_0381 PE=4 SV=1
P0DJ97	6.98e-09	770	835	664	729	Putative Gly-rich membrane protein Bcell_0380 OS=Evansella cellulosilytica (strain ATCC 21833 / DSM 2522 / FERM P-1141 / JCM 9156 / N-4) OX=649639 GN=Bcell_0380 PE=4 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000037	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
890	907