CAZyme Information: MGYG000002596_00778

Basic Information

• Species: Mediterraneibacter sp900555215
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Mediterraneibacter; Mediterraneibacter sp900555215
• CAZyme ID: MGYG000002596_00778
• CAZy Family: GH20
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1532	MGYG000002596_16|CGC1	167547.95	4.166

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002596	2662706	MAG	China	Asia

• Gene Location: Start: 10863; End: 15461 Strand: +

Full Sequence      

MKKSGRKATAMLLAAALTVSGLPGLLAAEAEAAPLETVGNNLVLRKDVIASSTANNAGPE
LAVDGVKDQAKQWNSDGMKSWEASDTSRDEDEQTPQWIQIDRGADAKPASVTSIKLWYNM
RVWPMEYQILTAKTSDLTADPKDTSVDLAEWTEVVSVKRQSSNGFVVNGTGQDIADTEAN
TDTITEDTNPALAEDVQLQRFVLVYITKVNAQAPGNNVNLREIEIFDDTVNVDVNAVLDS
ISAQDLVITDGRVTVNKEAAGAKIYVRGSGLENVVDNDGNLNGYNIGEKEVTLIVRVENE
KDPSQYAEKNLTVIVPDQSAAYPQEYFPQTAEPNAKPNAKPEVIPSLQEWYGYSGEFELS
EATRIIYNDAAEAGIEAAAANMKTDLLDITGLDLAVTEGTAEDAGENDIYIESQTEDTYK
VGDEGYLIVTDDSGLKIYAPSYTGCLYGTISVEQILYQADGNRTVPKGITRDYPAYEIRG
VMLDVARTPYRIQQLQDYAKVLLWYKMNEYHLHINDNDNCNISASVEDHSGFHRLESETF
PSLKSEVKHAGVPSDLINADYYENNEDYQGNPTYMKEQWRALKDVCESKGINMLTEIDLP
GHSLLYNKYAEENPDNIPKLKGGVKYTAGGLSNKGGEELLDLTGENAERALWFAETLWDE
YTDPDREGGPVISGDVVHIGADEYWDHSTPGIRDKFALFADSLRKVIQGNLGEGTKIRMW
GAGSVMFSTAETVLPDVDLPANYQLDVWYHGYEDAKARAAEGYEIINCRDAFMYGNPGRT
NRDVPNAEFVYNEWNPTMFQDGAPGTETNPLLGEPKLLGAKTVIWGDQSQEGMTERDVNQ
RVLRAVSIVSEKTWNSTDENGTFEKFEQRAARLAEGPGTQIAMETDSKTSLVLDYDFDNL
SSDGMTVFDTSGNGYNGTLSEKGEVSEDGYLTFDGSTVKTPLKTLSYPYTAAFTVRIDAE
EAEQNTTASSIFSGYDGQLQIAGTKDGSLSANVNYFTRDFNYSVPTDGREVKVMLVGTFQ
GTKLYINGQLQTFLSQKKDQDGTAAGSVTTMYSSFPLPLEKIGEGLHGEIADLQVYNKAF
SAEEAAAYYTDSWTSETSKVNVAQNTYAGGTSREVGDAANYDNADGRVKVAFKAVDGDAF
TNAQNAADRMDETTSDIYSYWKGNRSDSSLSIDLGQVRNVSEVQIQWRYGGKGKDFDIQI
SEDGETWTTWKKIRGNQDFLSTMSADGQPVQARYVRMQGISSNSESGYMIQEFMVYEITD
KTALAAKLAEAQKIIKEKGLGFETEDSTDRELFEAAVQAEAVNENALTTADDIEQAAARL
TAALEAQTEPEPEKEYAVTAGKADGAEITVPEKSKAGETVTIKVNVTDSDKEIDTVTVTG
ASGAAEVTKTGESEYTFIMPEEDVNVTVSLKDKAADKTALDQKIKEAEALKESDYTSATW
KAFRDALNTAKLVSADPDADQAEVDAALKNLENAVNGLKPVQQEIEKPNQPGAEDKAVET
GDTFGNGWICLMLLSGAALAVIAVNRKKKNLC

Enzyme Prediction     

No EC number prediction in MGYG000002596_00778.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH20	470	856	1.4e-43	0.9762611275964391
CBM32	1142	1254	4.3e-20	0.8467741935483871

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06564	GH20_DspB_LnbB-like	1.67e-65	477	854	1	324	Glycosyl hydrolase family 20 (GH20) catalytic domain of dispersin B (DspB), lacto-N-biosidase (LnbB) and related proteins. Dispersin B is a soluble beta-N-acetylglucosamidase found in bacteria that hydrolyzes the beta-1,6-linkages of PGA (poly-beta-(1,6)-N-acetylglucosamine), a major component of the extracellular polysaccharide matrix. Lacto-N-biosidase hydrolyzes lacto-N-biose (LNB) type I oligosaccharides at the nonreducing terminus to produce lacto-N-biose as part of the GNB/LNB (galacto-N-biose/lacto-N-biose I) degradation pathway. The lacto-N-biosidase from Bifidobacterium bifidum has this GH20 domain, a carbohydrate binding module 32, and a bacterial immunoglobulin-like domain 2, as well as a YSIRK signal peptide and a G5 membrane anchor at the N and C termini, respectively. The GH20 hexosaminidases are thought to act via a catalytic mechanism in which the catalytic nucleophile is not provided by solvent or the enzyme, but by the substrate itself.
cd02742	GH20_hexosaminidase	1.34e-20	478	854	1	302	Beta-N-acetylhexosaminidases of glycosyl hydrolase family 20 (GH20) catalyze the removal of beta-1,4-linked N-acetyl-D-hexosamine residues from the non-reducing ends of N-acetyl-beta-D-hexosaminides including N-acetylglucosides and N-acetylgalactosides. These enzymes are broadly distributed in microorganisms, plants and animals, and play roles in various key physiological and pathological processes. These processes include cell structural integrity, energy storage, cellular signaling, fertilization, pathogen defense, viral penetration, the development of carcinomas, inflammatory events and lysosomal storage disorders. The GH20 enzymes include the eukaryotic beta-N-acetylhexosaminidases A and B, the bacterial chitobiases, dispersin B, and lacto-N-biosidase. The GH20 hexosaminidases are thought to act via a catalytic mechanism in which the catalytic nucleophile is not provided by the solvent or the enzyme, but by the substrate itself.
pfam00728	Glyco_hydro_20	1.90e-20	476	854	1	343	Glycosyl hydrolase family 20, catalytic domain. This domain has a TIM barrel fold.
COG3525	Chb	6.26e-19	408	948	192	703	N-acetyl-beta-hexosaminidase [Carbohydrate transport and metabolism].
pfam00754	F5_F8_type_C	7.23e-15	1159	1253	24	127	F5/8 type C domain. This domain is also known as the discoidin (DS) domain family.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AMN35076.1	2.07e-183	41	1256	191	1268
AXH51903.1	1.11e-181	41	1261	191	1273
ASY50997.1	1.14e-179	41	1261	191	1273
AWS25495.1	1.14e-179	41	1261	191	1273
QQA11576.1	3.09e-179	41	1261	191	1273

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6JQF_A	3.32e-46	260	1070	25	726	Crystallizationanalysis of a beta-N-acetylhexosaminidase (Am2136) from Akkermansia muciniphila [Akkermansia muciniphila ATCC BAA-835]
4H04_A	3.90e-24	344	857	37	477	Lacto-N-biosidasefrom Bifidobacterium bifidum [Bifidobacterium bifidum JCM 1254],4H04_B Lacto-N-biosidase from Bifidobacterium bifidum [Bifidobacterium bifidum JCM 1254],4JAW_A Crystal Structure of Lacto-N-Biosidase from Bifidobacterium bifidum complexed with LNB-thiazoline [Bifidobacterium bifidum JCM 1254],4JAW_B Crystal Structure of Lacto-N-Biosidase from Bifidobacterium bifidum complexed with LNB-thiazoline [Bifidobacterium bifidum JCM 1254],5BXP_A LNBase in complex with LNB-LOGNAc [Bifidobacterium bifidum JCM 1254],5BXP_B LNBase in complex with LNB-LOGNAc [Bifidobacterium bifidum JCM 1254],5BXR_A LNBase in complex with LNB-NHAcDNJ [Bifidobacterium bifidum JCM 1254],5BXR_B LNBase in complex with LNB-NHAcDNJ [Bifidobacterium bifidum JCM 1254],5BXS_A LNBase in complex with LNB-NHAcCAS [Bifidobacterium bifidum JCM 1254],5BXS_B LNBase in complex with LNB-NHAcCAS [Bifidobacterium bifidum JCM 1254],5BXT_A LNBase in complex with LNB-NHAcAUS [Bifidobacterium bifidum JCM 1254],5BXT_B LNBase in complex with LNB-NHAcAUS [Bifidobacterium bifidum JCM 1254]
7BWG_A	7.09e-15	357	873	37	498	AGlycoside Hydrolase Family 20 beta-N-Acetylglucosaminidase [Microbacterium sp. HJ5],7BWG_B A Glycoside Hydrolase Family 20 beta-N-Acetylglucosaminidase [Microbacterium sp. HJ5]
6JE8_A	7.25e-15	424	683	37	258	crystalstructure of a beta-N-acetylhexosaminidase [Akkermansia muciniphila ATCC BAA-835],6JEA_A crystal structure of a beta-N-acetylhexosaminidase [Akkermansia muciniphila ATCC BAA-835],6JEB_A crystal structure of a beta-N-acetylhexosaminidase [Akkermansia muciniphila ATCC BAA-835]
6Q63_A	2.23e-13	357	604	46	271	BT0459[Bacteroides thetaiotaomicron],6Q63_B BT0459 [Bacteroides thetaiotaomicron],6Q63_C BT0459 [Bacteroides thetaiotaomicron]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B2UPR7	6.99e-49	260	1075	47	753	Beta-hexosaminidase Amuc_2136 OS=Akkermansia muciniphila (strain ATCC BAA-835 / DSM 22959 / JCM 33894 / BCRC 81048 / CCUG 64013 / CIP 107961 / Muc) OX=349741 GN=Amuc_2136 PE=1 SV=1
P43077	4.38e-18	409	867	97	519	Beta-hexosaminidase OS=Candida albicans OX=5476 GN=HEX1 PE=1 SV=1
B2UP57	4.43e-14	424	683	58	279	Beta-hexosaminidase Amuc_2018 OS=Akkermansia muciniphila (strain ATCC BAA-835 / DSM 22959 / JCM 33894 / BCRC 81048 / CCUG 64013 / CIP 107961 / Muc) OX=349741 GN=Amuc_2018 PE=1 SV=1
P96155	2.50e-13	355	603	153	371	Beta-hexosaminidase OS=Vibrio furnissii OX=29494 GN=exoI PE=1 SV=1
P49008	1.87e-11	393	683	82	335	Beta-hexosaminidase OS=Porphyromonas gingivalis (strain ATCC BAA-308 / W83) OX=242619 GN=nahA PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000245	0.999055	0.000173	0.000187	0.000158	0.000139

TMHMM  Annotations     

start	end
1503	1525