CAZyme Information: MGYG000002599_00023

Basic Information

• Species: Olsenella sp003862195
• Lineage: Bacteria; Actinobacteriota; Coriobacteriia; Coriobacteriales; Atopobiaceae; Olsenella; Olsenella sp003862195
• CAZyme ID: MGYG000002599_00023
• CAZy Family: GH23
• CAZyme Description: Membrane-bound lytic murein transglycosylase C

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
196		21904.89	5.8878

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002599	2063834	MAG	China	Asia

• Gene Location: Start: 27596; End: 28186 Strand: -

Full Sequence      

MMRERFWRWYRTIPIVCMLLACVLSAASNLLPSKVIRTVFYPVKYADVIEQASQRYGVDE
YLICAVIKCESNWDASATSNAGAVGLMQLMPSTSEAVAKMGSVDSSTYSPDNLTDPTTNI
MYGTAYLAYLQKNLSTRDQVIAAYNAGLGSVSKWLANGSDISQHIQYSETASYLVRVNEA
YERYKQFYPSGISEFQ

Enzyme Prediction     

No EC number prediction in MGYG000002599_00023.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	59	185	3.5e-27	0.8148148148148148

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd16896	LT_Slt70-like	5.26e-55	42	183	1	146	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd13401	Slt70-like	4.56e-43	41	185	2	150	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
cd00254	LT-like	1.38e-33	62	182	3	111	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
COG0741	MltE	2.50e-33	24	188	118	287	Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) [Cell wall/membrane/envelope biogenesis].
pfam01464	SLT	2.74e-33	49	157	1	105	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SDR81479.1	3.06e-109	5	192	5	192
ADK68420.1	4.31e-95	2	193	1	193
AKT50021.1	1.65e-66	18	192	1	179
QOY61251.1	1.72e-64	5	193	16	204
QPR42159.1	5.12e-63	3	192	3	193

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1SLY_A	1.13e-18	41	184	449	600	ComplexOf The 70-Kda Soluble Lytic Transglycosylase With Bulgecin A [Escherichia coli]
1QSA_A	9.66e-18	41	184	449	600	CrystalStructure Of The 70 Kda Soluble Lytic Transglycosylase Slt70 From Escherichia Coli At 1.65 Angstroms Resolution [Escherichia coli],1QTE_A Crystal Structure Of The 70 Kda Soluble Lytic Transglycosylase Slt70 From Escherichia Coli At 1.90 A Resolution In Complex With A 1,6- Anhydromurotripeptide [Escherichia coli]
4C5F_A	4.32e-17	20	186	152	340	Structureof Lytic Transglycosylase MltC from Escherichia coli at 2.3 A resolution. [Escherichia coli],4C5F_B Structure of Lytic Transglycosylase MltC from Escherichia coli at 2.3 A resolution. [Escherichia coli]
4CFO_A	1.12e-16	20	186	152	340	Structureof Lytic Transglycosylase MltC from Escherichia coli in complex with tetrasaccharide at 2.9 A resolution. [Escherichia coli],4CFO_B Structure of Lytic Transglycosylase MltC from Escherichia coli in complex with tetrasaccharide at 2.9 A resolution. [Escherichia coli],4CFP_A Crystal structure of MltC in complex with tetrasaccharide at 2.15 A resolution [Escherichia coli],4CFP_B Crystal structure of MltC in complex with tetrasaccharide at 2.15 A resolution [Escherichia coli],4CHX_A Crystal structure of MltC in complex with disaccharide pentapeptide DHl89 [Escherichia coli],4CHX_B Crystal structure of MltC in complex with disaccharide pentapeptide DHl89 [Escherichia coli]
6FBT_A	7.51e-11	41	177	445	585	ChainA, Lytic murein transglycosylase [Pseudomonas aeruginosa]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
C5BCE9	3.99e-17	44	193	190	341	Membrane-bound lytic murein transglycosylase C OS=Edwardsiella ictaluri (strain 93-146) OX=634503 GN=mltC PE=3 SV=1
Q57K03	4.02e-17	20	186	171	359	Membrane-bound lytic murein transglycosylase C OS=Salmonella choleraesuis (strain SC-B67) OX=321314 GN=mltC PE=3 SV=2
P0AGC3	5.35e-17	41	184	476	627	Soluble lytic murein transglycosylase OS=Escherichia coli (strain K12) OX=83333 GN=slt PE=1 SV=1
P0AGC4	5.35e-17	41	184	476	627	Soluble lytic murein transglycosylase OS=Escherichia coli O157:H7 OX=83334 GN=slt PE=3 SV=1
O31608	6.68e-17	23	181	40	179	Putative murein lytic transglycosylase YjbJ OS=Bacillus subtilis (strain 168) OX=224308 GN=yjbJ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.943395	0.042323	0.009126	0.000192	0.000125	0.004867

TMHMM  Annotations     

start	end
9	31