CAZyme Information: MGYG000002599_00667

Basic Information

• Species: Olsenella sp003862195
• Lineage: Bacteria; Actinobacteriota; Coriobacteriia; Coriobacteriales; Atopobiaceae; Olsenella; Olsenella sp003862195
• CAZyme ID: MGYG000002599_00667
• CAZy Family: GH5
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
347		38932.05	7.3474

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002599	2063834	MAG	China	Asia

• Gene Location: Start: 36404; End: 37447 Strand: -

Full Sequence      

MAERALHGVNLSGWLTLEPWVSPVLFADSGALDEESLVTSLGKTHYRDLVREHRANFVKQ
TDFTHIAARGFNAVRLPVPWYVFGDDGPDAGPFLGCIAQVDRAFDWADDINLNLVLVLDI
APGSASDQTSLVRNHSDFGHYRNDMIAVLGMLAKRYATRASFAGIEVADSPVAQVRHGLT
LTDGVPIHRLRNYYRDAYDAIRREAGDDLRVIIPAAHEPASWRHFMAHDRYKNVWLDCHL
YHYTDDVRTAGPSGVRTLVNKSQKSLRAARRSGLPVMVGKWSAALPFADSMTTPEGRIAL
ERVYISEQLAAFRDCAGWFYQTWKTDGKLSSWDARISLASFERRMLS

Enzyme Prediction     

No EC number prediction in MGYG000002599_00667.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	53	321	1e-46	0.9834437086092715

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG2730	BglC	1.23e-11	4	333	16	371	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].
pfam00150	Cellulase	0.002	57	281	24	236	Cellulase (glycosyl hydrolase family 5).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SDR87855.1	1.52e-239	1	347	1	347
ADK68544.1	3.61e-171	1	346	1	346
AKT48931.1	2.09e-165	1	347	1	346
QOY61077.1	9.30e-148	1	346	1	346
QUC04868.1	3.67e-139	6	346	1	342

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6ZB9_A	1.99e-39	6	324	3	358	ChainA, Exo-beta-1,3-glucanase [uncultured bacterium],6ZB9_B Chain B, Exo-beta-1,3-glucanase [uncultured bacterium]
6ZB8_A	1.99e-39	6	324	3	358	ChainA, Exo-beta-1,3-glucanase variant E167Q/E295Q [uncultured bacterium],6ZB8_B Chain B, Exo-beta-1,3-glucanase variant E167Q/E295Q [uncultured bacterium]
1H4P_A	2.07e-21	6	335	13	382	Crystalstructure of exo-1,3-beta glucanse from Saccharomyces cerevisiae [Saccharomyces cerevisiae],1H4P_B Crystal structure of exo-1,3-beta glucanse from Saccharomyces cerevisiae [Saccharomyces cerevisiae]
3N9K_A	2.61e-21	3	326	11	367	F229A/E292SDouble Mutant of Exo-beta-1,3-glucanase from Candida albicans in Complex with Laminaritriose at 1.7 A [Candida albicans]
1EQP_A	8.61e-21	3	326	6	362	Exo-b-(1,3)-glucanaseFrom Candida Albicans [Candida albicans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A1D4Q5	1.63e-31	6	340	42	399	Probable glucan 1,3-beta-glucosidase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=exgA PE=3 SV=1
B0XN12	1.14e-30	6	340	42	399	Probable glucan 1,3-beta-glucosidase A OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=exgA PE=3 SV=1
A1CRV0	1.55e-30	3	340	39	398	Probable glucan 1,3-beta-glucosidase A OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=exgA PE=3 SV=2
A2RAR6	2.17e-30	3	340	39	399	Probable glucan 1,3-beta-glucosidase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=exgA PE=3 SV=1
Q4WK60	1.09e-29	6	340	42	399	Probable glucan 1,3-beta-glucosidase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=exgA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000086	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002599_00667.