CAZyme Information: MGYG000002600_00948

Basic Information

• Species: Eubacterium_T sp900766045
• Lineage: Bacteria; Firmicutes_A; Clostridia; Peptostreptococcales; Anaerovoracaceae; Eubacterium_T; Eubacterium_T sp900766045
• CAZyme ID: MGYG000002600_00948
• CAZy Family: GT2
• CAZyme Description: 2-phospho-L-lactate guanylyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
459	MGYG000002600_10|CGC1	52807.1	9.8058

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002600	2448724	MAG	China	Asia

• Gene Location: Start: 42289; End: 43668 Strand: -

Full Sequence      

MTEKRAVILFTRIPVPGLTKTRLMPYYTPEQCAELHLCFLRDIRRNLSGIDADLFIYYAE
PGDPAVLKEIFGNRLPRPRHGWIHGSGKITYRLQVDLGLGERMYQAMEDVLNEGYDSCVL
TGTDLPDLTKEIFEDAFARLKTHDVVLGPTRDGGYYLIGSKAPQHVCFENQVYGGSSVFE
NTAAAVLNHGLSLSLAEVLHDVDTRSDLIHRLDRRRRHTEKPFLESDRYIAAHVKISVIV
PVYNEIKLVRQIQRELKKKFSSCEVIFVDGNSADGTAEKIDEKYTRLKSEKGRAKQMNLG
AQRASGDILFFLHCDSRLPKDPQREIRRVYISNLAGCFKIGFPTKRFLMLTNSILSNRRV
KEDGIMFGDQGIFIDRRLFMKMGGFPNIPLMEDYELSRELKRHGISIGMTRKKLISSDRR
YPRSTKGTLRLMKKMYDMRQMYLHGVSPEKLAEKYRDIR

Enzyme Prediction     

No EC number prediction in MGYG000002600_00948.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
TIGR04283	glyco_like_mftF	5.86e-79	236	455	1	220	transferase 2, rSAM/selenodomain-associated. This enzyme may transfer a nucleotide, or it sugar moiety, as part of a biosynthetic pathway. Other proposed members of the pathway include another transferase (TIGR04282), a phosphoesterase, and a radical SAM enzyme (TIGR04167) whose C-terminal domain (pfam12345) frequently contains a selenocysteine. [Unknown function, Enzymes of unknown specificity]
TIGR04282	glyco_like_cofC	5.80e-73	7	208	1	189	transferase 1, rSAM/selenodomain-associated. Members of this protein family show strongly correlated phylogenetic distribution, and in most cases co-clustering, with an unusual radical SAM enzyme (TIGR04167) whose C-terminal pfam12345 domain often contains a selenocysteine residue. Other members of the conserved gene neighborhood include another putative glycosyltransferase, an alkylhydroperoxidase family protein (TIGR04169), and a phosphoesterase family protein (TIGR04168). The cassette is likely to be biosynthetic but its exact function is unknown. [Unknown function, Enzymes of unknown specificity]
cd02522	GT_2_like_a	6.03e-64	236	455	1	221	GT_2_like_a represents a glycosyltransferase family-2 subfamily with unknown function. Glycosyltransferase family 2 (GT-2) subfamily of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
pfam09837	DUF2064	2.77e-28	52	170	10	115	Uncharacterized protein conserved in bacteria (DUF2064). This family has structural similarity to proteins in the nucleotide-diphospho-sugar transferases superfamily. The similarity suggests that it is an enzyme with a sugar substrate.
COG3222	COG3222	8.07e-26	1	208	1	197	Uncharacterized conserved protein, glycosyltransferase A (GT-A) superfamily, DUF2064 family [Function unknown].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIX90246.1	4.45e-136	4	459	2	443
CBK78105.1	4.60e-136	4	459	2	444
QRP38681.1	2.53e-135	4	459	2	443
ASN96524.1	2.53e-135	4	459	2	443
SET56509.1	3.83e-135	4	459	2	445

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3CGX_A	1.42e-22	3	208	3	198	ChainA, Putative nucleotide-diphospho-sugar transferase [Oleidesulfovibrio alaskensis G20]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000023	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002600_00948.