CAZyme Information: MGYG000002601_01300

Basic Information

• Species: CAG-110 sp900549705
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Oscillospiraceae; CAG-110; CAG-110 sp900549705
• CAZyme ID: MGYG000002601_01300
• CAZy Family: GH3
• CAZyme Description: Beta-hexosaminidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
508	MGYG000002601_42|CGC1	55254.29	5.1578

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002601	2683696	MAG	China	Asia

• Gene Location: Start: 12992; End: 14518 Strand: -

Full Sequence      

MEIREMLGQKLVFGFHGTQITEEFKELIRRYKIGNVILFLRNVESASQLRQLCSDVQTLI
REETGYPAFIIIDQEGGMVSRLPEDAVDVPGAMALAATGDPENARLASEITIRQLRGLGA
NFNMAPVLDVNSNPANPVIGVRSFGDDPERVAAFGCASIAPYENSGVLCCVKHFPGHGDT
AVDSHLGLPRVDKTEEELEQLELIPFRRAIAAGVPAVMMSHVLFPNIADDQLPCTMSRRM
VTDLLRNKLGFRGLVLTDCMEMLAIQKHYGTPQGVVAAIRAGVDLAEISSRMDLEEASAK
AVNEAAARGELNLQEIQESVERILKFKQQLFTAPDAALCNLQRDRQAAWNLSRQAVTQVG
GKPFRADEHTFFCGCADYRVSGAANEDGKKATFPEFMAHHFGTRCLVTSKDPTEEEIQEV
VRQAAGAEKIVLGTCNGHLFAGQQQLAAALSRLQKPMAVVALRNPYDLSGLPETLWKLCC
YDYDAPALAGVAEVLSGGAATGVCPVKL

Enzyme Prediction     

No EC number prediction in MGYG000002601_01300.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	62	285	1.9e-61	0.9629629629629629

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1472	BglX	2.89e-85	1	349	1	334	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
pfam00933	Glyco_hydro_3	3.30e-80	3	324	2	314	Glycosyl hydrolase family 3 N terminal domain.
PRK05337	PRK05337	2.76e-53	17	285	10	276	beta-hexosaminidase; Provisional
PRK15098	PRK15098	1.69e-10	90	334	121	362	beta-glucosidase BglX.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QJD88473.1	3.48e-156	11	497	1	491
QUH30605.1	4.99e-150	1	508	3	514
QHX43084.1	1.49e-145	3	499	6	505
AIW90186.1	2.98e-145	3	499	6	505
AUS97055.1	3.08e-144	1	497	3	506

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6K5J_A	1.69e-98	1	508	11	531	Structureof a glycoside hydrolase family 3 beta-N-acetylglucosaminidase from Paenibacillus sp. str. FPU-7 [Paenibacillaceae]
4ZM6_A	1.91e-92	7	497	13	515	Aunique GCN5-related glucosamine N-acetyltransferase region exist in the fungal multi-domain GH3 beta-N-acetylglucosaminidase [Rhizomucor miehei CAU432],4ZM6_B A unique GCN5-related glucosamine N-acetyltransferase region exist in the fungal multi-domain GH3 beta-N-acetylglucosaminidase [Rhizomucor miehei CAU432]
3BMX_A	2.37e-72	1	508	42	617	Beta-N-hexosaminidase(YbbD) from Bacillus subtilis [Bacillus subtilis],3BMX_B Beta-N-hexosaminidase (YbbD) from Bacillus subtilis [Bacillus subtilis],3NVD_A Structure of YBBD in complex with pugnac [Bacillus subtilis],3NVD_B Structure of YBBD in complex with pugnac [Bacillus subtilis]
3LK6_A	7.38e-72	1	508	16	591	ChainA, Lipoprotein ybbD [Bacillus subtilis],3LK6_B Chain B, Lipoprotein ybbD [Bacillus subtilis],3LK6_C Chain C, Lipoprotein ybbD [Bacillus subtilis],3LK6_D Chain D, Lipoprotein ybbD [Bacillus subtilis]
4GYJ_A	1.41e-71	1	508	46	621	Crystalstructure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYJ_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYK_A Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168],4GYK_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P40406	1.30e-71	1	508	42	617	Beta-hexosaminidase OS=Bacillus subtilis (strain 168) OX=224308 GN=nagZ PE=1 SV=1
P48823	8.94e-66	5	330	20	383	Beta-hexosaminidase A OS=Pseudoalteromonas piscicida OX=43662 GN=cht60 PE=1 SV=1
B2FPW9	8.02e-48	11	309	2	302	Beta-hexosaminidase OS=Stenotrophomonas maltophilia (strain K279a) OX=522373 GN=nagZ PE=3 SV=1
Q0A911	3.01e-47	6	285	1	279	Beta-hexosaminidase OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) OX=187272 GN=nagZ PE=3 SV=1
B4SRK3	1.59e-46	11	309	2	302	Beta-hexosaminidase OS=Stenotrophomonas maltophilia (strain R551-3) OX=391008 GN=nagZ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000067	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002601_01300.