CAZyme Information: MGYG000002603_00034

Basic Information

• Species: Prevotella sp900767615
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp900767615
• CAZyme ID: MGYG000002603_00034
• CAZy Family: GH115
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
852		96766.32	8.437

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002603	2739364	MAG	China	Asia

• Gene Location: Start: 47036; End: 49594 Strand: -

Full Sequence      

MKLNKDKKIFFVSMALLSSLGMSAADQFVSFQKGDLLINRDNKVEIYMDANDCKGVSYAA
NALVKDIIKVSGSKTVLTSDAGLKDKNATGKPTILVGTIGHSAAIDQLIRQKRINGNLLK
GKREKFIITVVDGQLVIAGSDRRGTIYGIYELSQQMGVSPWYDWADVPVVHHDSIFVNKG
IYTDGEPAVRYRGIFLNDEAPCLTSWVKNTYGTEYGDHRFYQRVFELVLRLRGNMMWPAM
WGWAFYADDPENEKTADEMGVVMSTSHHEPMARNHQEYARNRKGWGPWNYQKNKENLQKF
FREGIERMKGTEQIVTIGMRGDGDEAMSDKADTRLMTNIINDQRKIIADVTGKKASETPQ
VWALYKEVLDYYDKGMKVPDDVTLLLCDDNWGNVRRVPNAKERKHKGGWGLYYHVDYVGA
PRNSKMLNVTPVQNPWEQLTLAYENGIDRLWILNVGDLKPMEYPISQFMDMAWNPHKYSV
NNITRHTRNWCAQQFGESQADEAARILNLICKYNGRCTPEMLDKNTYSLENGEWQEIVNQ
YLQLEADALRQYNSLPAAYHDAYRQIILFPIEVMSNLHQMYFAQAQNNTLYKQGNPKANV
WADECERLFKRDSIICDYYNHKMSGGKWNGMMTQKHIGYTSWNDAFEKDTCPQLFRVSVS
EAPVIAEHNGVVEIEAPFFASKTDAAPQGKEKEGAKWVQIPFMGKSLAGMTLMPYTKGVK
GASITYQFKMNALARNAASSNTTDSKKVRIHVITKSTLDYQNKGGMTYGVSIDGAKPTIV
NFNQDLNEKPKNIYSIYYPTIATRIIDKVIEVELPVTGDGIHTITLTPNAPAIIFEKIVI
DGREGKQRVKVI

Enzyme Prediction     

EC	3.2.1.131

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH115	37	838	5.8e-271	0.9913916786226685

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam15979	Glyco_hydro_115	0.0	185	521	1	334	Glycosyl hydrolase family 115. Glyco_hydro_115 is a family of glycoside hydrolases likely to have the activity of xylan a-1,2-glucuronidase, EC:3.2.1.131, or a-(4-O-methyl)-glucuronidase EC:3.2.1.-.
pfam17829	GH115_C	5.86e-30	667	841	4	159	Gylcosyl hydrolase family 115 C-terminal domain. This domain is found at the C-terminus of glycosyl hydrolase family 115 proteins. This domain has a beta-sandwich fold.
pfam03648	Glyco_hydro_67N	3.45e-04	86	152	56	120	Glycosyl hydrolase family 67 N-terminus. Alpha-glucuronidases, components of an ensemble of enzymes central to the recycling of photosynthetic biomass, remove the alpha-1,2 linked 4-O-methyl glucuronic acid from xylans. This family represents the N-terminal region of alpha-glucuronidase. The N-terminal domain forms a two-layer sandwich, each layer being formed by a beta sheet of five strands. A further two helices form part of the interface with the central, catalytic, module (pfam07488).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNT66545.1	0.0	1	852	1	852
BCS85271.1	0.0	12	841	7	814
CCG34758.1	0.0	36	841	1	784
AGB29053.1	0.0	7	841	6	817
QVJ82146.1	0.0	10	841	13	808

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4C90_A	0.0	7	841	13	835	Evidencethat GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C90_B Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C91_A Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C91_B Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus]
7PUG_A	0.0	37	841	19	820	ChainA, xylan alpha-1,2-glucuronidase [uncultured bacterium]
7PXQ_A	0.0	37	841	18	819	ChainA, xylan alpha-1,2-glucuronidase [uncultured bacterium]
4ZMH_A	2.21e-180	28	644	5	622	Crystalstructure of a five-domain GH115 alpha-Glucuronidase from the Marine Bacterium Saccharophagus degradans 2-40T [Saccharophagus degradans 2-40],4ZMH_B Crystal structure of a five-domain GH115 alpha-Glucuronidase from the Marine Bacterium Saccharophagus degradans 2-40T [Saccharophagus degradans 2-40]
6NPS_A	4.24e-117	47	649	23	652	Crystalstructure of GH115 enzyme AxyAgu115A from Amphibacillus xylanus [Amphibacillus xylanus NBRC 15112],6NPS_B Crystal structure of GH115 enzyme AxyAgu115A from Amphibacillus xylanus [Amphibacillus xylanus NBRC 15112]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000828	0.998201	0.000390	0.000216	0.000169	0.000158

TMHMM  Annotations     

start	end
9	31