CAZyme Information: MGYG000002603_01685

Basic Information

• Species: Prevotella sp900767615
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp900767615
• CAZyme ID: MGYG000002603_01685
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
438		51584.04	9.3738

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002603	2739364	MAG	China	Asia

• Gene Location: Start: 9619; End: 10935 Strand: +

Full Sequence      

MFSIAEHLNDFFDWISTLSFSSIVNTYWFLFFIEMPRYYILEYLVIGNRLMKRNQIDKEK
EYAKYFLYRENPLISILVPGKNEGKHIFKMVNSLAEQTYRNYEIIVVDDGSDDDTKLICN
DLYRAGYITHYLRLDTRGGKAAASNYGAQMAKGKYIVCLDADSSLDRDALEKILLPFYID
GMVKGVGGCVKVRNYKETICSSLQAFEYLKRIQVGRIVTSELGIYHIISGAFGAFERKTL
KEVGYWDIGPGLDGDLTQKIRKAGYKVKFAEDAICMTNVPTKWYKLYHQRIRWSRSFVRF
RLRKHIDILLPTKNWSILNWISNMESVMFDCFLNFLWLWYIINLAITFNTHIVEVLALGY
FIRVCFSQLAFLLVLMVSERKKDVWFLYRYLPLMSPYTGYFLRIARLSAHLQEFFFRRSY
KDAWNPEKTSRYAQLEGI

Enzyme Prediction     

No EC number prediction in MGYG000002603_01685.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	75	243	1.5e-32	0.9882352941176471

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06423	CESA_like	1.11e-51	76	247	1	173	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
PRK11204	PRK11204	2.89e-42	1	397	3	381	N-glycosyltransferase; Provisional
COG1215	BcsA	1.71e-41	27	431	14	435	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
PRK14583	hmsR	9.95e-32	71	381	74	387	poly-beta-1,6 N-acetyl-D-glucosamine synthase.
pfam00535	Glycos_transf_2	2.43e-31	75	238	1	162	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNT65453.1	0.0	1	438	1	438
BCS85412.1	2.39e-222	9	436	3	437
APD07883.1	1.10e-144	6	438	3	435
AZJ36032.1	6.90e-142	24	438	26	440
CAG5084162.1	9.58e-137	3	438	4	440

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5HEA_A	8.80e-15	73	173	6	105	CgTstructure in hexamer [Streptococcus parasanguinis FW213],5HEA_B CgT structure in hexamer [Streptococcus parasanguinis FW213],5HEA_C CgT structure in hexamer [Streptococcus parasanguinis FW213],5HEC_A CgT structure in dimer [Streptococcus parasanguinis FW213],5HEC_B CgT structure in dimer [Streptococcus parasanguinis FW213]
2Z87_A	5.90e-12	58	180	360	481	Crystalstructure of chondroitin polymerase from Escherichia coli strain K4 (K4CP) complexed with UDP-GalNAc and UDP [Escherichia coli],2Z87_B Crystal structure of chondroitin polymerase from Escherichia coli strain K4 (K4CP) complexed with UDP-GalNAc and UDP [Escherichia coli]
2Z86_A	5.91e-12	58	180	361	482	Crystalstructure of chondroitin polymerase from Escherichia coli strain K4 (K4CP) complexed with UDP-GlcUA and UDP [Escherichia coli],2Z86_B Crystal structure of chondroitin polymerase from Escherichia coli strain K4 (K4CP) complexed with UDP-GlcUA and UDP [Escherichia coli],2Z86_C Crystal structure of chondroitin polymerase from Escherichia coli strain K4 (K4CP) complexed with UDP-GlcUA and UDP [Escherichia coli],2Z86_D Crystal structure of chondroitin polymerase from Escherichia coli strain K4 (K4CP) complexed with UDP-GlcUA and UDP [Escherichia coli]
3BCV_A	3.84e-10	72	168	5	100	Crystalstructure of a putative glycosyltransferase from Bacteroides fragilis [Bacteroides fragilis NCTC 9343],3BCV_B Crystal structure of a putative glycosyltransferase from Bacteroides fragilis [Bacteroides fragilis NCTC 9343]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P75905	1.88e-31	69	296	72	299	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Escherichia coli (strain K12) OX=83333 GN=pgaC PE=1 SV=1
Q8XAR5	1.88e-31	69	296	72	299	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Escherichia coli O157:H7 OX=83334 GN=pgaC PE=3 SV=1
Q5HKQ0	6.36e-28	58	296	29	270	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) OX=176279 GN=icaA PE=1 SV=1
Q8GLC5	1.63e-27	58	296	29	270	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus epidermidis OX=1282 GN=icaA PE=3 SV=1
Q6GDD8	6.89e-26	74	342	49	308	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus aureus (strain MRSA252) OX=282458 GN=icaA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999600	0.000409	0.000003	0.000001	0.000001	0.000006

TMHMM  Annotations     

start	end
11	33
333	352
356	378
385	407