CAZyme Information: MGYG000002604_00637

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Butyricicoccaceae; AM07-15
• CAZyme ID: MGYG000002604_00637
• CAZy Family: GT51
• CAZyme Description: Monofunctional biosynthetic peptidoglycan transglycosylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
708		76879.85	4.3519

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002604	1992821	MAG	China	Asia

• Gene Location: Start: 2066; End: 4192 Strand: +

Full Sequence      

MKRKVAEIMRALELDKKYDKDDILEMYMNTIYLGQGANGVKAAAQTYFGKDPIDLSLAEC
AAIAGITKNPYKYDPIRFPEFNKERRYLVLEQMQKYGYISEEEMNAAKAEELQLRQDTQE
KEDEQVWSYFVDEVFNSVVEDLMEQKGYSKEVAKQMIYTGGLRIVSTLDPEVQAQMDAVF
EDVDNLPGVLGKDGTMPQCSMVIMGQEGEVKALYGGRGQKEGNLVLNRATRTRRSPGSSI
KPISVYAPAIEMGLITPISVLDDVPKDFSVKSGGWPKNSTNGRVWQGRMTVKKAVEVSNN
TIPVGLVQQMGAETAFDFAYNNMGLKSLEKGRNVQDRKGNSKYVSDVALSPMALGGLTDG
VTVEEMTAAYAAFGAGGMYYKPRVYSKVYDSQGNVILDNTAAGTAAMTEKTADYMLDLLI
NVVTGSQGTGARAKIKGIETAGKTGTTDDDYDRWFAGLTPYYTGVVWFGYDTPQVVKGVS
TNPALAIWKSVMERVHEPLENKSFTRNTEMVNVSYCMDSGLRATEACQSDPRGSRVVSGR
VAKSDVPKESCNVHEMAQIDGTTGMLANEYCPEAELKNVGMLRIDRSFPIPGVVVSDAQY
VLPGSDSSGYPAASNAENPANQTCTVHNAENDGNKPPEEEEPEDPENPGGPEDPDQPTTP
GEPADNDPDEPGDEGGGESQGGSPGGDNKPDPLPPEEGDPSNEGKPAA

Enzyme Prediction     

No EC number prediction in MGYG000002604_00637.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT51	1	94	2.4e-33	0.5254237288135594

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
TIGR02074	PBP_1a_fam	5.63e-139	2	497	74	530	penicillin-binding protein, 1A family. Bacterial that synthesize a cell wall of peptidoglycan (murein) generally have several transglycosylases and transpeptidases for the task. This family consists of bifunctional transglycosylase/transpeptidase penicillin-binding proteins (PBP). In the Proteobacteria, this family includes PBP 1A but not the paralogous PBP 1B (TIGR02071). This family also includes related proteins, often designated PBP 1A, from other bacterial lineages. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
COG0744	MrcB	2.60e-124	2	507	149	608	Membrane carboxypeptidase (penicillin-binding protein) [Cell wall/membrane/envelope biogenesis].
COG5009	MrcA	4.40e-89	2	578	139	790	Membrane carboxypeptidase/penicillin-binding protein [Cell wall/membrane/envelope biogenesis].
pfam00912	Transgly	5.51e-40	1	94	84	177	Transglycosylase. The penicillin-binding proteins are bifunctional proteins consisting of transglycosylase and transpeptidase in the N- and C-terminus respectively. The transglycosylase domain catalyzes the polymerization of murein glycan chains.
COG4953	PbpC	1.90e-39	4	606	131	669	Membrane carboxypeptidase/penicillin-binding protein PbpC [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIA31344.1	6.12e-153	1	638	170	817
ANU41033.1	3.52e-152	1	638	146	793
QNL43378.1	1.93e-144	1	627	168	776
QBB65500.1	6.33e-135	1	623	143	778
ALP94484.1	1.41e-134	1	623	175	810

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3ZG8_B	4.36e-63	13	471	2	433	CrystalStructure of Penicillin Binding Protein 4 from Listeria monocytogenes in the Ampicillin bound form [Listeria monocytogenes],3ZG9_B Crystal Structure of Penicillin-Binding Protein 4 from Listeria monocytogenes in the Cefuroxime bound form [Listeria monocytogenes],3ZGA_B Crystal Structure of Penicillin-Binding Protein 4 from Listeria monocytogenes in the Carbenicillin bound form [Listeria monocytogenes]
3ZG7_B	3.39e-56	13	471	2	433	CrystalStructure of Penicillin-Binding Protein 4 from Listeria monocytogenes in the apo form [Listeria monocytogenes]
7U4H_A	9.33e-55	1	573	109	834	ChainA, Penicillin-binding protein 1A (Pbp1a) [Chlamydia trachomatis D/UW-3/CX],7U4H_B Chain B, Penicillin-binding protein 1A (Pbp1a) [Chlamydia trachomatis D/UW-3/CX]
4OON_A	8.44e-41	3	488	112	715	Crystalstructure of PBP1a in complex with compound 17 ((4Z,8S,11E,14S)-5-(2-amino-1,3-thiazol-4-yl)-14-(5,6-dihydroxy-1,3-dioxo-1,3-dihydro-2H-isoindol-2-yl)-8-formyl-2-methyl-6-oxo-3,10-dioxa-4,7,11-triazatetradeca-4,11-diene-2,12,14-tricarboxylic acid) [Pseudomonas aeruginosa PAO1]
3DWK_A	1.50e-36	3	471	100	558	ChainA, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL],3DWK_B Chain B, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL],3DWK_C Chain C, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL],3DWK_D Chain D, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q0TNZ8	7.34e-83	3	554	168	724	Penicillin-binding protein 1A OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) OX=195103 GN=pbpA PE=3 SV=1
A7GHV1	4.97e-82	1	609	151	754	Penicillin-binding protein 1A OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) OX=441772 GN=pbpA PE=3 SV=1
A5I6G4	1.40e-81	1	609	151	754	Penicillin-binding protein 1A OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) OX=441771 GN=pbpA PE=3 SV=1
A7FY32	1.40e-81	1	609	151	754	Penicillin-binding protein 1A OS=Clostridium botulinum (strain ATCC 19397 / Type A) OX=441770 GN=pbpA PE=3 SV=1
Q0SRL7	8.35e-81	3	560	168	730	Penicillin-binding protein 1A OS=Clostridium perfringens (strain SM101 / Type A) OX=289380 GN=pbpA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000058	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002604_00637.