CAZyme Information: MGYG000002605_00654

Basic Information

• Species: UBA6984 sp003258725
• Lineage: Bacteria; Cyanobacteria; Vampirovibrionia; Gastranaerophilales; Gastranaerophilaceae; UBA6984; UBA6984 sp003258725
• CAZyme ID: MGYG000002605_00654
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
375	MGYG000002605_4|CGC1	43143.58	8.7568

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002605	1854240	MAG	China	Asia

• Gene Location: Start: 6166; End: 7293 Strand: +

Full Sequence      

MKKVFIITGEYSGDMHASNVARHLLEMNSDIQIEAIGGESLKAMGIKLFADHSKMSAMGL
SPRILLDHIKLGKDLVNYLTKEYKPDLVLLIDYGAFNLKMARFLKKAGIRINYYIPPQVW
ASRKYRIKAIKKYVDEVFCIFPFEKEMYESYGIKTTYCGHPLISQLPQPANREEFFAKYG
LDPNKKLVSVFSGSRKFELKNLMETFIKSAKILKKMHPDIQIVFSQAPSIKDEVFKKYYK
DCDFKVIQGDNQALLSCSDALILASGTVALEASLYNTPMIISYKGPILFWFIYLLVRCIN
RVCLPNIIMDMDIVPEILELQAKPDFIAYNIEKLLYDEDARNKQIEGLKSVREKLSDKNS
SYEVAKEIHRELFED

Enzyme Prediction     

No EC number prediction in MGYG000002605_00654.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	4	355	9.2e-101	0.9915254237288136

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00025	lpxB	1.99e-119	1	368	1	371	lipid-A-disaccharide synthase; Reviewed
COG0763	LpxB	1.39e-103	1	372	1	379	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
pfam02684	LpxB	4.14e-76	4	355	1	359	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
TIGR00215	lpxB	1.27e-66	4	366	8	380	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK14089	PRK14089	4.04e-43	1	368	1	344	lipid-A-disaccharide synthase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AOR39331.1	6.32e-162	1	373	1	373
VEH12442.1	1.38e-68	2	374	5	381
AKQ33376.1	1.51e-68	2	366	6	370
BAU23905.1	4.19e-67	3	368	2	363
AJC50314.1	6.24e-67	2	366	6	370

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8S_A	5.73e-43	4	335	9	345	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]
5W8N_A	1.56e-42	4	335	9	345	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B6J161	4.24e-65	2	373	4	375	Lipid-A-disaccharide synthase OS=Coxiella burnetii (strain CbuG_Q212) OX=434923 GN=lpxB PE=3 SV=1
A9KC41	5.97e-65	2	373	4	375	Lipid-A-disaccharide synthase OS=Coxiella burnetii (strain Dugway 5J108-111) OX=434922 GN=lpxB PE=3 SV=1
Q83DS5	5.97e-65	2	373	4	375	Lipid-A-disaccharide synthase OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) OX=227377 GN=lpxB PE=3 SV=1
A9NCA7	5.97e-65	2	373	4	375	Lipid-A-disaccharide synthase OS=Coxiella burnetii (strain RSA 331 / Henzerling II) OX=360115 GN=lpxB PE=3 SV=1
Q39T49	1.14e-63	2	365	7	373	Lipid-A-disaccharide synthase OS=Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15) OX=269799 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000046	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002605_00654.