CAZyme Information: MGYG000002608_01264

Basic Information

• Species: CAG-485 sp900541835
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; CAG-485; CAG-485 sp900541835
• CAZyme ID: MGYG000002608_01264
• CAZy Family: GH0
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
761		82868.91	6.3065

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002608	2400131	MAG	China	Asia

• Gene Location: Start: 79883; End: 82168 Strand: +

Full Sequence      

MKQICILIAAAACALGARAAATDTVVATPAYAWVGDSILQGPFRAYAVSPFEITGNYSAR
PGYYMGVDRTWKQKNDLRAYPRLKTPEKLLAAVYNMGLDEMVNAVEPDTTLRTGKEWAGV
WTRDVSYSIILSMAALQPEASMISLRKKVDPLGRIVQDTGSGGAWPVSTDRMVWLLAAWE
VYKVTGDHAWLEFAYRAGVRSMADDHATAYGPDGLVRGETSFIDWREQSYPRWMQTADIY
RSEAMSTNVVHAAAMGILADMARQLGKRKEAADWAARSEGLARLINDAFYMPDKGYYGMY
RYGRQNLVLLDREETLGEALAILYGIASPARAVTITESVPVTPYGPAIFYPQIADMPSYH
NNALWPFVAAYWTLANARAGNEAGIMQGFGSIVRPAALFATNKENFNLDNGDIYTELNSS
NMLWSLSGNLALTQQVLFGIHFEPDGLRIAPVVPKALAATRTLENFPYRGARLNITVSGH
GNRIRTLRVNGKERPVTDGCFLTARELRHGADIDIVLADNDLTTSKVNGQPNLKAPLTPM
AWLDTDPATGATQLSWNPIEYIAGYEVLHNGRKVADTRTTSWPVAEIGEWQVAGVASDGT
RSFASEPRYVGETLAFQLPGEGTAVASKEVSYAPAAPVQGYHGQGFREVDHATGAITIPI
AVKAAGTYALTLRYANGNGPVNTENKCAIRSVSVNGRRAGAVVMPQRGVANWNDWGLTNP
VLVDLPAGASEVTVTFADTDENMNRLTNHALIDELLAAPVR

Enzyme Prediction     

No EC number prediction in MGYG000002608_01264.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04083	CBM35_Lmo2446-like	7.26e-16	640	740	22	114	Carbohydrate Binding Module 35 (CBM35) domains similar to Lmo2446. This family includes carbohydrate binding module 35 (CBM35) domains that are appended to several carbohydrate binding enzymes. Some CBM35 domains belonging to this family are appended to glycoside hydrolase (GH) family domains, including glycoside hydrolase family 31 (GH31), for example the CBM35 domain of Lmo2446, an uncharacterized protein from Listeria monocytogenes EGD-e. These CBM35s are non-catalytic carbohydrate binding domains that facilitate the strong binding of the GH catalytic modules with their dedicated, insoluble substrates. GH31 has a wide range of hydrolytic activities such as alpha-glucosidase, alpha-xylosidase, 6-alpha-glucosyltransferase, or alpha-1,4-glucan lyase, cleaving a terminal carbohydrate moiety from a substrate that may be a starch or a glycoprotein. Most characterized GH31 enzymes are alpha-glucosidases.
pfam17389	Bac_rhamnosid6H	1.02e-09	152	298	65	222	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
cd04082	CBM35_pectate_lyase-like	6.01e-08	640	747	21	123	Carbohydrate Binding Module family 35 (CBM35), pectate lyase-like; appended mainly to enzymes that bind mannan (Man), xylan, glucuronic acid (GlcA) and possibly glucans. This family includes carbohydrate binding module family 35 (CBM35) domains that are non-catalytic carbohydrate binding domains that are appended mainly to enzymes that bind mannan (Man), xylan, glucuronic acid (GlcA) and possibly glucans. Included in this family are CBM35s of pectate lyases, including pectate lyase 10A from Cellvibrio japonicas, these enzymes release delta-4,5-anhydrogalaturonic acid (delta4,5-GalA) from pectin, thus identifying a signature molecule for plant cell wall degradation. CBM35s are unique in that they display conserved specificity through extensive sequence similarity but divergent function through their appended catalytic modules. They are known to bind alpha-D-galactose (Gal), mannan (Man), xylan, glucuronic acid (GlcA), a beta-polymer of mannose, and possibly glucans, forming four subfamilies based on general ligand specificities (galacto, urono, manno, and gluco configurations). In contrast to most CBMs that are generally rigid proteins, CBM35 undergoes significant conformational change upon ligand binding. Some CBM35s bind their ligands in a calcium-dependent manner, especially those binding uronic acids.
COG3408	GDB1	4.34e-06	117	476	281	641	Glycogen debranching enzyme (alpha-1,6-glucosidase) [Carbohydrate transport and metabolism].
cd04081	CBM35_galactosidase-like	7.12e-06	654	735	38	111	Carbohydrate Binding Module family 35 (CBM35); appended mainly to enzymes that bind alpha-D-galactose (CBM35-Gal), including glycoside hydrolase (GH) families GH27 and GH43. This family includes carbohydrate binding module family 35 (CBM35); these are non-catalytic carbohydrate binding domains that are appended mainly to enzymes that bind alpha-D-galactose (CBM35-Gal), including glycoside hydrolase (GH) families GH27 and GH43. Examples of proteins which contain CBM35s belonging to this family includes the CBM35 of an exo-beta-1,3-galactanase from Phanerochaete chrysosporium 9 (Pc1,3Gal43A) which is appended to a GH43 domain, and the CBM35 domain of two bifunctional proteins with beta-L-arabinopyranosidase/alpha-D-galactopyranosidase activities from Fusarium oxysporum 12S, Foap1 and Foap2 (Fo/AP1 and Fo/AP2), that are appended to GH27 domains. CBM35s are unique in that they display conserved specificity through extensive sequence similarity but divergent function through their appended catalytic modules. They are known to bind alpha-D-galactose (Gal), mannan (Man), xylan, glucuronic acid (GlcA), a beta-polymer of mannose, and possibly glucans, forming four subfamilies based on general ligand specificities (galacto, urono, manno, and gluco configurations). Some CBM35s bind their ligands in a calcium-dependent manner. In contrast to most CBMs that are generally rigid proteins, CBM35 undergoes significant conformational change upon ligand binding. GH43 includes beta-xylosidases and beta-xylanases, using aryl-glycosides as substrates, while family GH27 includes alpha-galactosidases, alpha-N-acetylgalactosaminidases, and isomaltodextranases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNK61875.1	4.16e-209	70	761	215	892
AKQ46615.1	3.60e-208	70	755	227	900
AMQ00027.1	2.88e-205	70	755	199	870
QDA62675.1	3.47e-205	71	761	201	882
QNE41784.1	9.70e-205	71	753	216	885

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000317	0.998327	0.000694	0.000231	0.000220	0.000194

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002608_01264.