CAZyme Information: MGYG000002609_01332

Basic Information

• Species: CAG-882 sp003486385
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; CAG-882; CAG-882 sp003486385
• CAZyme ID: MGYG000002609_01332
• CAZy Family: GH5
• CAZyme Description: Endoglucanase D

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
336	MGYG000002609_11|CGC2	38224.86	4.5965

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002609	3323522	MAG	China	Asia

• Gene Location: Start: 63116; End: 64126 Strand: +

Full Sequence      

MQDIIRNIRAGISIGNTLDAFEKDIKISDAPEKTETSWGNPVITQELVDAYIAAGLNIIR
IPVTWTGHFGGAPDYTIDGAWLRRVREVVDYAYGRGVYVILNLHHEGWNYPYYENEERAC
IIMTALWSQLAAEFAGYDEHLIFEGQNEPRKIGTSLEWNGGDEEGWEVVNSTNAAFVKAV
RQGTEYNKSRYLMIPGYAANCTVGIRHIDIPDDDRIIISVHAYEPYDFALNTEGRSQWQH
DTQMIDSLMTELRERFTGKGIPVIIGEFGAMNKDNEADRAEWVEYYIKAASKAGIRCIWW
DNGLFEGEGERFGLFDRHTYKCGYPKVLEGIQKGIE

Enzyme Prediction     

EC	3.2.1.4	3.2.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	35	303	2.1e-94	0.9891304347826086

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00150	Cellulase	5.99e-62	18	303	1	269	Cellulase (glycosyl hydrolase family 5).
COG2730	BglC	5.45e-35	23	308	55	365	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].
pfam03198	Glyco_hydro_72	0.008	165	269	143	248	Glucanosyltransferase. This is a family of glycosylphosphatidylinositol-anchored beta(1-3)glucanosyltransferases. The active site residues in the Aspergillus fumigatus example are the two glutamate residues at 160 and 261.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEO51792.1	1.38e-121	2	335	26	363
AAE59925.1	2.54e-119	2	335	26	363
AAD04193.1	2.54e-119	2	335	26	363
ANS13827.1	5.22e-119	2	335	19	356
ADK66823.1	5.80e-119	3	336	35	367

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3AYR_A	6.12e-117	2	334	21	359	GH5endoglucanase EglA from a ruminal fungus [Piromyces rhizinflatus]
3AYS_A	4.95e-116	2	334	21	359	GH5endoglucanase from a ruminal fungus in complex with cellotriose [Piromyces rhizinflatus]
6WQP_A	2.61e-100	2	333	17	354	GH5-4broad specificity endoglucanase from Ruminococcus champanellensis [Ruminococcus champanellensis],6WQP_B GH5-4 broad specificity endoglucanase from Ruminococcus champanellensis [Ruminococcus champanellensis],6WQV_A GH5-4 broad specificity endoglucanase from Ruminococcus champanellensis with bound cellotriose [Ruminococcus champanellensis],6WQV_B GH5-4 broad specificity endoglucanase from Ruminococcus champanellensis with bound cellotriose [Ruminococcus champanellensis],6WQV_C GH5-4 broad specificity endoglucanase from Ruminococcus champanellensis with bound cellotriose [Ruminococcus champanellensis],6WQV_D GH5-4 broad specificity endoglucanase from Ruminococcus champanellensis with bound cellotriose [Ruminococcus champanellensis]
3NDY_A	3.04e-94	2	335	13	341	Thestructure of the catalytic and carbohydrate binding domain of endoglucanase D from Clostridium cellulovorans [Clostridium cellulovorans],3NDY_B The structure of the catalytic and carbohydrate binding domain of endoglucanase D from Clostridium cellulovorans [Clostridium cellulovorans],3NDY_C The structure of the catalytic and carbohydrate binding domain of endoglucanase D from Clostridium cellulovorans [Clostridium cellulovorans],3NDY_D The structure of the catalytic and carbohydrate binding domain of endoglucanase D from Clostridium cellulovorans [Clostridium cellulovorans],3NDZ_A The structure of the catalytic and carbohydrate binding domain of endoglucanase D from Clostridium cellulovorans bound to cellotriose [Clostridium cellulovorans],3NDZ_B The structure of the catalytic and carbohydrate binding domain of endoglucanase D from Clostridium cellulovorans bound to cellotriose [Clostridium cellulovorans],3NDZ_C The structure of the catalytic and carbohydrate binding domain of endoglucanase D from Clostridium cellulovorans bound to cellotriose [Clostridium cellulovorans],3NDZ_D The structure of the catalytic and carbohydrate binding domain of endoglucanase D from Clostridium cellulovorans bound to cellotriose [Clostridium cellulovorans]
6PZ7_A	8.16e-92	2	331	10	333	GH5-4broad specificity endoglucanase from Clostridium acetobutylicum [Clostridium acetobutylicum ATCC 824]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q12647	1.24e-118	2	335	26	363	Endoglucanase B OS=Neocallimastix patriciarum OX=4758 GN=CELB PE=2 SV=1
P23660	7.83e-91	2	331	28	359	Endoglucanase A OS=Ruminococcus albus OX=1264 GN=celA PE=1 SV=1
P28623	9.89e-91	2	335	44	372	Endoglucanase D OS=Clostridium cellulovorans (strain ATCC 35296 / DSM 3052 / OCM 3 / 743B) OX=573061 GN=engD PE=1 SV=2
P54937	1.83e-88	2	336	40	379	Endoglucanase A OS=Clostridium longisporum OX=1523 GN=celA PE=1 SV=1
P23661	1.40e-85	2	336	72	401	Endoglucanase B OS=Ruminococcus albus OX=1264 GN=celB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000068	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002609_01332.