CAZyme Information: MGYG000002609_01661

Basic Information

• Species: CAG-882 sp003486385
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; CAG-882; CAG-882 sp003486385
• CAZyme ID: MGYG000002609_01661
• CAZy Family: GT2
• CAZyme Description: Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
382		42493.96	8.5527

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002609	3323522	MAG	China	Asia

• Gene Location: Start: 16971; End: 18119 Strand: -

Full Sequence      

MSYEYELTILMPCLNEAETLETCIKKAQTFLRENNVNGEVLIADNGSTDGSREIAVKAGA
RVVPIAQRGYGAALIGGCEAAKGEYVIMGDADDSYDFLHLMPFLEKLREGYELVMGNRFK
GGIAKGAMPPLHRYIGNPVLSFIGRLFYKSDIGDFHCGLRGYKRDSIMKLGLQTIGMEYA
SEMVVKATLYKLKITEVPTTLSPDGRSRAPHLRSFHDGWRHLKFLLMHSPSWLFLYPGIF
FTALGAVLMCILAANTITIGEVGFDINTLLYTSAMLMIGVNLILFNAFTRTYARVTGFIP
MPENEKKKFFTVDKGIFIGAVLFIIGLVLTIMALVGWNSRNFGQLNPQEMMRLTIPAVTF
MVTGVQVLFGSFFIGILEIKHK

Enzyme Prediction     

No EC number prediction in MGYG000002609_01661.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	8	170	1e-24	0.9882352941176471

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04179	DPM_DPG-synthase_like	1.99e-47	9	187	1	185	DPM_DPG-synthase_like is a member of the Glycosyltransferase 2 superfamily. DPM1 is the catalytic subunit of eukaryotic dolichol-phosphate mannose (DPM) synthase. DPM synthase is required for synthesis of the glycosylphosphatidylinositol (GPI) anchor, N-glycan precursor, protein O-mannose, and C-mannose. In higher eukaryotes,the enzyme has three subunits, DPM1, DPM2 and DPM3. DPM is synthesized from dolichol phosphate and GDP-Man on the cytosolic surface of the ER membrane by DPM synthase and then is flipped onto the luminal side and used as a donor substrate. In lower eukaryotes, such as Saccharomyces cerevisiae and Trypanosoma brucei, DPM synthase consists of a single component (Dpm1p and TbDpm1, respectively) that possesses one predicted transmembrane region near the C terminus for anchoring to the ER membrane. In contrast, the Dpm1 homologues of higher eukaryotes, namely fission yeast, fungi, and animals, have no transmembrane region, suggesting the existence of adapter molecules for membrane anchoring. This family also includes bacteria and archaea DPM1_like enzymes. However, the enzyme structure and mechanism of function are not well understood. The UDP-glucose:dolichyl-phosphate glucosyltransferase (DPG_synthase) is a transmembrane-bound enzyme of the endoplasmic reticulum involved in protein N-linked glycosylation. This enzyme catalyzes the transfer of glucose from UDP-glucose to dolichyl phosphate. This protein family belongs to Glycosyltransferase 2 superfamily.
pfam00535	Glycos_transf_2	8.71e-26	8	167	1	164	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
cd04188	DPG_synthase	5.44e-22	9	198	1	201	DPG_synthase is involved in protein N-linked glycosylation. UDP-glucose:dolichyl-phosphate glucosyltransferase (DPG_synthase) is a transmembrane-bound enzyme of the endoplasmic reticulum involved in protein N-linked glycosylation. This enzyme catalyzes the transfer of glucose from UDP-glucose to dolichyl phosphate.
COG0463	WcaA	7.22e-22	6	261	4	256	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].
cd04187	DPM1_like_bac	9.27e-20	9	165	1	157	Bacterial DPM1_like enzymes are related to eukaryotic DPM1. A family of bacterial enzymes related to eukaryotic DPM1; Although the mechanism of eukaryotic enzyme is well studied, the mechanism of the bacterial enzymes is not well understood. The eukaryotic DPM1 is the catalytic subunit of eukaryotic Dolichol-phosphate mannose (DPM) synthase. DPM synthase is required for synthesis of the glycosylphosphatidylinositol (GPI) anchor, N-glycan precursor, protein O-mannose, and C-mannose. The enzyme has three subunits, DPM1, DPM2 and DPM3. DPM is synthesized from dolichol phosphate and GDP-Man on the cytosolic surface of the ER membrane by DPM synthase and then is flipped onto the luminal side and used as a donor substrate. This protein family belongs to Glycosyltransferase 2 superfamily.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AFA47053.1	2.42e-178	4	382	5	385
ADG89866.1	7.23e-160	6	382	2	380
QSI49909.1	3.17e-157	11	382	1	374
AFZ08985.1	9.11e-156	6	382	14	392
ACZ91265.1	2.10e-155	6	381	2	379

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
D4GU74	3.00e-63	7	375	46	409	Low-salt glycan biosynthesis hexosyltransferase Agl6 OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) OX=309800 GN=agl6 PE=3 SV=1
D4GYG3	3.33e-23	9	289	9	285	Glycosyltransferase AglJ OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) OX=309800 GN=aglJ PE=1 SV=1
Q1JQ93	7.34e-16	1	198	21	228	Dolichol-phosphate mannosyltransferase subunit 1 OS=Bos taurus OX=9913 GN=DPM1 PE=2 SV=1
Q9WU83	1.09e-15	8	198	34	234	Dolichol-phosphate mannosyltransferase subunit 1 OS=Cricetulus griseus OX=10029 GN=DPM1 PE=2 SV=1
A5GFZ5	1.34e-15	8	198	27	227	Dolichol-phosphate mannosyltransferase subunit 1 OS=Sus scrofa OX=9823 GN=DPM1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000063	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
232	254
269	288
315	337
357	379