CAZyme Information: MGYG000002610_00111

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; Faecalibacterium
• CAZyme ID: MGYG000002610_00111
• CAZy Family: GH23
• CAZyme Description: Membrane-bound lytic murein transglycosylase C

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
221		25865.56	8.558

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002610	2250349	MAG	China	Asia

• Gene Location: Start: 129473; End: 130138 Strand: +

Full Sequence      

MNEQNHEKTYDPIVARERRAAWEKQRRRKQQRRRQRMLRLVTLFLAVVLAVCAAPPLCNR
LDRFLYPRKYEQLVEKWAAAYELDPLLVYAFIRTESGFDPQATSSVDARGLMQMTEETFL
WMRSKIAPDEPLTFADLYSPDTAIRFGCYYLHLCMVRYKGDVSTAAAAYHSGWGTVDQLL
QMEEHSADGQTLQGFPYNQMHHYVNKITACYQTYQRLYAGQ

Enzyme Prediction     

No EC number prediction in MGYG000002610_00111.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	83	215	4.7e-27	0.8222222222222222

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd16896	LT_Slt70-like	5.09e-53	67	212	1	145	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd13401	Slt70-like	2.32e-32	65	217	1	152	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
cd00254	LT-like	3.04e-26	85	212	1	111	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
pfam01464	SLT	3.72e-23	76	176	3	99	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.
COG0741	MltE	9.50e-21	49	220	118	289	Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AXB28497.1	8.95e-128	1	221	1	221
AXA80758.1	1.73e-98	39	220	13	194
CBK98413.1	4.94e-98	39	220	13	194
ATL89088.1	6.74e-92	40	220	8	187
ATO98725.1	3.18e-90	40	220	8	187

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MPQ_A	2.50e-09	59	220	400	561	BulgecinA: The key to a broad-spectrum inhibitor that targets lytic transglycosylases [Neisseria meningitidis]
5O1J_A	2.51e-09	59	220	404	565	Lytictransglycosylase in action [Neisseria meningitidis MC58]
6FPN_B	2.51e-09	59	220	410	571	Lytictransglycosylase in action [Neisseria meningitidis MC58]
5O24_A	2.52e-09	59	220	414	575	Lytictransglycosylase in action [Neisseria meningitidis]
5O29_A	2.53e-09	59	220	420	581	Lytictransglycosylase in action [Neisseria meningitidis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O31608	6.49e-12	71	211	61	179	Putative murein lytic transglycosylase YjbJ OS=Bacillus subtilis (strain 168) OX=224308 GN=yjbJ PE=3 SV=1
O64046	3.43e-10	66	211	1418	1541	Probable tape measure protein OS=Bacillus phage SPbeta OX=66797 GN=yomI PE=3 SV=1
O31976	3.43e-10	66	211	1418	1541	SPbeta prophage-derived uncharacterized transglycosylase YomI OS=Bacillus subtilis (strain 168) OX=224308 GN=yomI PE=3 SV=2
A9R6R2	1.79e-09	59	216	182	357	Membrane-bound lytic murein transglycosylase C OS=Yersinia pestis bv. Antiqua (strain Angola) OX=349746 GN=mltC PE=3 SV=1
Q1CB94	1.79e-09	59	216	182	357	Membrane-bound lytic murein transglycosylase C OS=Yersinia pestis bv. Antiqua (strain Antiqua) OX=360102 GN=mltC PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.994120	0.005046	0.000469	0.000030	0.000017	0.000300

TMHMM  Annotations     

start	end
37	59