CAZyme Information: MGYG000002613_01392

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella
• CAZyme ID: MGYG000002613_01392
• CAZy Family: GH105
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
448	MGYG000002613_67|CGC1	50389.49	6.6143

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002613	2968338	MAG	China	Asia

• Gene Location: Start: 13073; End: 14419 Strand: +

Full Sequence      

MTIKPLIITCLMMPSLTQAQDNNGNMNDSNTPLHLLKPDYRHGYGVSEKQDIKNAIDKVL
GYILDNPQQFRTTSYEWGVTYSACLDAADASGDNRYSNYVAENFKAIADEFPKAMRDLKK
GKKLETAIRKVVDPHALDDAGAICAAMIKAEIKSRQYAKTRSTPTIETAPVIANYAQYIM
EKEFRLADGTFARKRPHKNTVWLDDMFMAIPAIAYMGAYTGDQKYFDEAARQIMLFKEKM
WVPEKKLFRHGWVEAMTPHPAFHWGRANGWAILTMCEVLDVLPESHPQRSAVLQLLRQHI
EGLAALQGKDGFWHQLLDRQESYEESSCTAIYTYCIAHAINKGWISALAYGPVAQLAWHA
VEASIDGKGRVTGTCVGTGMGFDPAFYMYRPVSTAAAHGYGPVIWAGAEMLRLLDNQHPK
MNDSAVQFYPEAVDTDEPIFNYDGEIRF

Enzyme Prediction     

EC	3.2.1.172

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	68	412	9e-91	0.9759036144578314

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07470	Glyco_hydro_88	3.64e-90	75	414	29	343	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.
COG4225	YesR	2.62e-48	48	414	12	357	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AHF24578.1	1.83e-194	26	448	14	462
ADY37528.1	4.60e-183	11	441	11	461
AII64718.1	4.95e-182	19	441	22	464
QJR54147.1	4.95e-182	19	441	22	464
AII66354.1	4.95e-182	19	441	22	464

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3K11_A	7.67e-164	26	445	6	445	Crystalstructure of Putative glycosyl hydrolase (NP_813087.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 1.80 A resolution [Bacteroides thetaiotaomicron VPI-5482]
1NC5_A	4.04e-26	75	410	41	364	Structureof Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	1.67e-25	75	410	31	354	ChainA, Putative glycosyl hydrolase yteR [Bacillus subtilis]
3QWT_A	2.97e-23	202	412	167	378	ChainA, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_B Chain B, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_C Chain C, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_D Chain D, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A]
3PMM_A	6.35e-22	202	412	168	379	ChainA, Putative cytoplasmic protein [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O34559	2.21e-25	75	410	41	364	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1
O31521	1.18e-21	166	412	95	337	Unsaturated rhamnogalacturonyl hydrolase YesR OS=Bacillus subtilis (strain 168) OX=224308 GN=yesR PE=1 SV=1
P0A3U6	3.19e-13	208	413	1	231	Protein Atu3128 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) OX=176299 GN=Atu3128 PE=3 SV=1
P0A3U7	3.19e-13	208	413	1	231	24.9 kDa protein in picA locus OS=Rhizobium radiobacter OX=358 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000363	0.998870	0.000233	0.000170	0.000162	0.000151

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002613_01392.