CAZyme Information: MGYG000002613_01424

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella
• CAZyme ID: MGYG000002613_01424
• CAZy Family: GT27
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
351	MGYG000002613_70|CGC1	40398.93	8.4422

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002613	2968338	MAG	China	Asia

• Gene Location: Start: 9337; End: 10392 Strand: -

Full Sequence      

MRPLYIAALQVFLNMIYVMAKRIAIVILNWNGVSMLRKYLPGVISMSEDMADVWVADNAS
ADDSMKWVAENCPTAKNILLDKNYGFAEGYNKALEKVDAEYYVLLNSDVEVTEGWLRPLV
GLMDSDGKIAACQPKLLAIHDRTKFEYAGASGGFIDKYGYPFCRGRVLDVVETDNGQYDD
IAEIHWATGACLMIRKKCYWQAGGLDGRFFAHNEEIDLCWRLRLLGYRIMVQPASHVFHV
GGGTLPKENPMKTYLNFRNNLTMLYKNLPSNDLRHIMRVRCVLDYVAAAKMLLLERNIEE
AKAVLRGRRDFKKWRRLFDEDRQLVTSPNHHDAPLMPFCILWRRYFGKTNM

Enzyme Prediction     

No EC number prediction in MGYG000002613_01424.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT27	30	261	8.1e-21	0.8033898305084746

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04186	GT_2_like_c	7.51e-44	25	241	1	166	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
COG1216	GT2	1.73e-38	19	316	1	295	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].
TIGR03965	mycofact_glyco	6.45e-12	23	239	76	280	mycofactocin system glycosyltransferase. Members of this protein family are putative glycosyltransferases, members of pfam00535 (glycosyl transferase family 2). Members appear mostly in the Actinobacteria, where they appear to be part of a system for converting a precursor peptide (TIGR03969) into a novel redox carrier designated mycofactocin. A radical SAM enzyme, TIGR03962, is a proposed to be a key maturase for mycofactocin.
pfam00535	Glycos_transf_2	1.41e-11	25	133	2	113	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
cd00761	Glyco_tranf_GTA_type	5.13e-11	25	149	1	128	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNT66259.1	3.39e-149	22	345	3	328
ATV31336.1	1.63e-148	22	350	2	324
APW32367.1	2.32e-148	22	350	2	324
ATV28095.1	2.32e-148	22	350	2	324
BAU17232.1	3.29e-148	22	350	2	324

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P9WMY2	3.23e-10	36	239	18	235	N-acetylglucosaminyl-diphospho-decaprenol L-rhamnosyltransferase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=wbbL PE=3 SV=2
P9WMY3	3.23e-10	36	239	18	235	N-acetylglucosaminyl-diphospho-decaprenol L-rhamnosyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=wbbL PE=1 SV=2
P36667	2.83e-07	84	239	60	219	Rhamnosyltransferase WbbL OS=Escherichia coli (strain K12) OX=83333 GN=wbbL PE=1 SV=1
P46370	3.36e-07	91	239	196	329	Uncharacterized 55.3 kDa protein in thcA 5'region OS=Rhodococcus erythropolis OX=1833 PE=4 SV=1
Q50864	7.95e-07	73	239	629	792	O-antigen biosynthesis protein RfbC OS=Myxococcus xanthus OX=34 GN=rfbC PE=4 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.984899	0.014492	0.000514	0.000039	0.000021	0.000050

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002613_01424.