CAZyme Information: MGYG000002613_01633

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella
• CAZyme ID: MGYG000002613_01633
• CAZy Family: GH3
• CAZyme Description: Xylan 1,4-beta-xylosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
311	MGYG000002613_89|CGC1	34888.68	7.3728

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002613	2968338	MAG	China	Asia

• Gene Location: Start: 3844; End: 4779 Strand: +

Full Sequence      

MNKLLTSIVLLSIGTITFAQSEPYKNPELSAHDRAVDLCSRLTLEEKTLLMMDVSPAIER
LGISEFHWWNEALHGVGRNGCATVFPATIGMAASFDSNLLYDIFTAVSDEARAKNTLARQ
SKKIKRYQGLSFWTPNINIFRDPRWGRGQETYGEDPYLTSKMGLAVVKGLQGPENSKYRK
LLACAKHFAVHSGPESSRHSFNIQSLPERDLWETYLPAFKSLVQEGHVAEVMCAYQSIDN
EPCCGNNRYLQQILRNEWGYKNIVVSDCGAISDFWKQGCHEFVNTGHEAAGIAVRRGTDL
ECGSVYKALRL

Enzyme Prediction     

EC	3.2.1.37	3.2.1.-	3.2.1.21	3.2.1.55

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	57	302	3.2e-67	0.9814814814814815

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PLN03080	PLN03080	4.42e-71	19	304	37	332	Probable beta-xylosidase; Provisional
COG1472	BglX	1.14e-52	56	306	53	282	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
pfam00933	Glyco_hydro_3	2.23e-42	60	309	63	292	Glycosyl hydrolase family 3 N terminal domain.
PRK15098	PRK15098	4.80e-40	51	300	92	317	beta-glucosidase BglX.
PRK05337	PRK05337	1.09e-05	183	267	162	249	beta-hexosaminidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADD92016.1	1.63e-146	2	309	3	311
ADY37431.1	6.85e-144	13	309	9	312
ALJ60264.1	3.65e-140	3	309	6	311
QDO68481.1	1.02e-139	3	309	6	311
EDV05842.1	1.54e-139	3	309	22	327

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7VC7_A	4.64e-57	34	306	25	304	ChainA, xylan 1,4-beta-xylosidase [Phanerodontia chrysosporium]
7VC6_A	4.64e-57	34	306	25	304	ChainA, xylan 1,4-beta-xylosidase [Phanerodontia chrysosporium]
6Q7I_A	2.81e-47	23	307	41	327	GH3exo-beta-xylosidase (XlnD) [Aspergillus nidulans FGSC A4],6Q7I_B GH3 exo-beta-xylosidase (XlnD) [Aspergillus nidulans FGSC A4],6Q7J_A Chain A, Exo-1,4-beta-xylosidase xlnD [Aspergillus nidulans FGSC A4],6Q7J_B Chain B, Exo-1,4-beta-xylosidase xlnD [Aspergillus nidulans FGSC A4]
5A7M_A	2.32e-46	33	306	51	328	ChainA, BETA-XYLOSIDASE [Trichoderma reesei],5A7M_B Chain B, BETA-XYLOSIDASE [Trichoderma reesei]
5AE6_A	2.33e-46	33	306	51	328	ChainA, BETA-XYLOSIDASE [Trichoderma reesei],5AE6_B Chain B, BETA-XYLOSIDASE [Trichoderma reesei]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
D5EY15	1.79e-120	11	306	11	306	Xylan 1,4-beta-xylosidase OS=Prevotella ruminicola (strain ATCC 19189 / JCM 8958 / 23) OX=264731 GN=xyl3A PE=1 SV=1
A5JTQ3	1.47e-61	26	304	56	338	Beta-xylosidase/alpha-L-arabinofuranosidase 2 OS=Medicago sativa subsp. varia OX=36902 GN=Xyl2 PE=2 SV=1
Q9FLG1	1.17e-60	19	304	38	343	Beta-D-xylosidase 4 OS=Arabidopsis thaliana OX=3702 GN=BXL4 PE=1 SV=1
Q0CB82	1.30e-60	34	306	52	330	Probable exo-1,4-beta-xylosidase bxlB OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=bxlB PE=3 SV=1
Q9FGY1	2.01e-60	32	303	57	330	Beta-D-xylosidase 1 OS=Arabidopsis thaliana OX=3702 GN=BXL1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000242	0.999107	0.000157	0.000161	0.000151	0.000138

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002613_01633.