CAZyme Information: MGYG000002613_01663

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella
• CAZyme ID: MGYG000002613_01663
• CAZy Family: CE8
• CAZyme Description: Pectinesterase A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
323		36775.89	8.7054

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002613	2968338	MAG	China	Asia

• Gene Location: Start: 9261; End: 10232 Strand: +

Full Sequence      

MRLLTTIIVALTAMTTFGANKYDNPDTLFVSRDGTAEFRNIADAIEVCRAFMEYHKVIFV
KKGTYKEKLVIPSWLDNIEICGEDRDKTIITYDDHANIKLPGTEKGMGTFRTYTLKIEGN
GITLKNITIENNAARLGQAVTLHTEGDRLVFKNCRFLGNQDTIYTGKASSRLYFNGCYIE
GTTDFIFGPSTAWFENCEIFSKANSYITAASTPAGQKYGYIFTHCKLTAMPEVTKVYLGR
PWRPYAHTLFMNCELGKHIRGEGWENWRKPDNEKTARYEEYGNTGEGASLSKRVAWSRVL
SKKEAQAITIEKVFDRKDSWRPF

Enzyme Prediction     

No EC number prediction in MGYG000002613_01663.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	29	315	4.3e-101	0.9861111111111112

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam01095	Pectinesterase	7.20e-74	30	310	4	291	Pectinesterase.
PLN02773	PLN02773	2.40e-70	28	320	7	302	pectinesterase
COG4677	PemB	9.81e-66	6	314	54	402	Pectin methylesterase and related acyl-CoA thioesterases [Carbohydrate transport and metabolism, Lipid transport and metabolism].
PLN02432	PLN02432	2.08e-58	30	320	15	291	putative pectinesterase
PLN02682	PLN02682	8.49e-58	27	306	70	353	pectinesterase family protein

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS84477.1	1.53e-175	19	322	20	323
QVJ81978.1	2.17e-165	2	322	3	322
ADE82952.1	2.17e-165	2	322	3	322
AGB28242.1	3.19e-165	7	322	7	323
QJR97878.1	3.59e-156	19	322	13	318

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1XG2_A	2.12e-41	30	296	7	277	ChainA, Pectinesterase 1 [Solanum lycopersicum]
1GQ8_A	1.27e-39	30	309	11	297	Pectinmethylesterase from Carrot [Daucus carota]
5C1E_A	1.75e-37	28	293	11	271	CrystalStructure of the Pectin Methylesterase from Aspergillus niger in Penultimately Deglycosylated Form (N-acetylglucosamine Stub at Asn84) [Aspergillus niger ATCC 1015]
5C1C_A	9.42e-37	28	293	11	271	CrystalStructure of the Pectin Methylesterase from Aspergillus niger in Deglycosylated Form [Aspergillus niger ATCC 1015]
2NSP_A	5.10e-31	31	322	12	339	ChainA, Pectinesterase A [Dickeya dadantii 3937],2NSP_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NST_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NST_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT6_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT6_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT9_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT9_B Chain B, Pectinesterase A [Dickeya dadantii 3937]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9LVQ0	5.69e-54	30	305	9	287	Pectinesterase 31 OS=Arabidopsis thaliana OX=3702 GN=PME31 PE=1 SV=1
P41510	1.23e-48	27	310	272	563	Probable pectinesterase/pectinesterase inhibitor OS=Brassica napus OX=3708 GN=BP19 PE=2 SV=1
Q5MFV6	3.49e-48	27	310	276	567	Probable pectinesterase/pectinesterase inhibitor VGDH2 OS=Arabidopsis thaliana OX=3702 GN=VGDH2 PE=2 SV=2
Q42608	5.29e-47	27	310	259	550	Pectinesterase/pectinesterase inhibitor (Fragment) OS=Brassica campestris OX=3711 PE=2 SV=1
O80722	6.69e-47	30	299	279	555	Pectinesterase 4 OS=Arabidopsis thaliana OX=3702 GN=PME4 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000255	0.999131	0.000168	0.000147	0.000141	0.000131

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002613_01663.