CAZyme Information: MGYG000002613_01679

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella
• CAZyme ID: MGYG000002613_01679
• CAZy Family: GH23
• CAZyme Description: Membrane-bound lytic murein transglycosylase F

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
402	MGYG000002613_93|CGC1	44650.82	8.5762

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002613	2968338	MAG	China	Asia

• Gene Location: Start: 5005; End: 6213 Strand: -

Full Sequence      

MYPLYMNIRHLYILLLPSLLLLSCDRQPKAVTTPWGTVVEGDSTDAETGGFSLSDIQTNG
ELIVLTMSGPDTYYEYHGRGMGVQYLLAERFAQKLGVSLRVEVCKDTAEMVRQLKNGEGD
IVAFMLPKGMKGLTMAGVSDSCKTKGWAVAQGNSELAATLNGWYKKNMMADAVKEESFAL
STKSVTRKVYSPMLNRAGGVISRYDHLFQQYAPLARWDWRLVAAQCYQESTFDPQARSWA
GACGLMQIMPSTADMLGLAFSDIFDPEKNIAAACKYLGQLNGKFSDVGSREERTKFILAS
YNGGFYHIRDAMALAEKYGKNKYSWADVSHYVLGLQSPQYYNDPVVKNGYMRGSETVGYV
ERIMGRYADYRGVARSGSSFSSFGSGPQSPHRSTKTNKYQVD

Enzyme Prediction     

No EC number prediction in MGYG000002613_01679.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	217	370	1.4e-28	0.8148148148148148

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd13403	MLTF-like	1.18e-78	208	371	1	160	membrane-bound lytic murein transglycosylase F (MLTF) and similar proteins. This subfamily includes membrane-bound lytic murein transglycosylase F (MltF, murein lyase F) that degrades murein glycan strands. It is responsible for catalyzing the release of 1,6-anhydromuropeptides from peptidoglycan. Lytic transglycosylase catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc) as do goose-type lysozymes. However, in addition, it also makes a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
PRK10859	PRK10859	2.09e-52	52	369	35	448	membrane-bound lytic murein transglycosylase MltF.
COG4623	MltF	1.57e-49	53	363	16	424	Membrane-bound lytic murein transglycosylase MltF [Cell wall/membrane/envelope biogenesis, Signal transduction mechanisms].
pfam01464	SLT	3.47e-23	218	323	11	114	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.
cd13401	Slt70-like	3.96e-23	204	304	6	107	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VEH15587.1	1.52e-169	9	401	29	433
ALO48082.1	1.54e-166	21	401	15	391
AGB28026.1	4.17e-162	14	395	31	410
EFC70077.2	1.88e-160	6	401	1	391
BCS86517.1	5.01e-160	23	376	9	361

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4OYV_A	1.92e-24	52	369	10	426	Crystalstructure of MltF from Pseudomonas aeruginosa complexed with leucine [Pseudomonas aeruginosa PAO1]
4OZ9_A	4.53e-24	52	369	3	419	Crystalstructure of MltF from Pseudomonas aeruginosa complexed with isoleucine [Pseudomonas aeruginosa PAO1]
4OWD_A	4.83e-24	52	369	10	426	Crystalstructure of MltF from Pseudomonas aeruginosa complexed with cysteine [Pseudomonas aeruginosa PAO1],4OXV_A Crystal structure of MltF from Pseudomonas aeruginosa complexed with valine [Pseudomonas aeruginosa PADK2_CF510],4P0G_A Crystal structure of MltF from Pseudomonas aeruginosa complexed with bulgecin and muropeptide [Pseudomonas aeruginosa PAO1],4P11_A Native crystal structure of MltF Pseudomonas aeruginosa [Pseudomonas aeruginosa PAO1]
5AA2_B	7.65e-24	52	369	44	460	Crystalstructure of MltF from Pseudomonas aeruginosa in complex with NAM-pentapeptide. [Pseudomonas aeruginosa BWHPSA013]
5AA2_A	7.65e-24	52	369	44	460	Crystalstructure of MltF from Pseudomonas aeruginosa in complex with NAM-pentapeptide. [Pseudomonas aeruginosa BWHPSA013],5AA2_C Crystal structure of MltF from Pseudomonas aeruginosa in complex with NAM-pentapeptide. [Pseudomonas aeruginosa BWHPSA013]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A8ZWR8	5.89e-31	52	367	33	445	Membrane-bound lytic murein transglycosylase F OS=Desulfococcus oleovorans (strain DSM 6200 / JCM 39069 / Hxd3) OX=96561 GN=mltF PE=3 SV=2
A8AD27	8.93e-29	53	363	36	444	Membrane-bound lytic murein transglycosylase F OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) OX=290338 GN=mltF PE=3 SV=1
A4WDC7	6.82e-27	53	363	36	444	Membrane-bound lytic murein transglycosylase F OS=Enterobacter sp. (strain 638) OX=399742 GN=mltF PE=3 SV=1
A0KJ50	1.08e-26	45	367	32	450	Membrane-bound lytic murein transglycosylase F OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049) OX=380703 GN=mltF PE=3 SV=1
Q2NS21	2.12e-26	52	363	35	443	Membrane-bound lytic murein transglycosylase F OS=Sodalis glossinidius (strain morsitans) OX=343509 GN=mltF PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000001	0.000064	0.999985	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002613_01679.