CAZyme Information: MGYG000002614_00232

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Phocaeicola
• CAZyme ID: MGYG000002614_00232
• CAZy Family: GH3
• CAZyme Description: Thermostable beta-glucosidase B

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
782	MGYG000002614_8|CGC1	85111.16	5.6766

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002614	2560607	MAG	China	Asia

• Gene Location: Start: 16536; End: 18884 Strand: +

Full Sequence      

MKSILITTTACLFMSVAPVMAQQPLYKQASAPVEERIDDLLGRMTLEEKVGQICCPLGWE
MYTKTGKNSVTISDLYKKQMSEAPIGSYWAVLRADPWTQKTLETGLNPELAAKALNALQK
YAVEETRLGIPVLFAEECPHGHMSIGATVFPTSMAQASTWNKNLIFSMGEAIGLEARSQG
ANIGYGPVLDIAREPRWSRVEETFGEDPYLTGILGTAFVKGMQGTDYKDGKHVYSTLKHL
AAYGVPRGGHNGNPADIGMRALFDEYLPGFQRAVEEGKAATVMTSYNSIDGVPCTSNTFL
IDSVLRKRWGFEGFVYSDLASIDGIAGGNVAADMEDAAIQAIKAGTDMDLGANAYKRLVK
AVKEGRIEEKYIDRAVENVLRLKFNMGLFENPYVSPKEAKAVVNCDAHRQIARQIAREGT
VLLKNDGILPLSKSLKRVAVIGPNADVMYNYLGDYTAPQERSKVVTILDAVRAKLPNAQV
DYVKGCAIRDTTQSNIAEAVQAAQKADVIILAVGGSSARDFKTKYINTGAATVSNEGDGI
VSDMECGEGFDRATLNLLGDQEKLLKALAATGKPLVTVYIAGRPLNMNLANEKSQALLTA
WYPGEQGGNGIVDVLFGDYNPSGRLPMSVPRNEGQIPVHYSQGPQRDYMDSPGTPLFTFG
YGLSYTTFGYSNLRLEEGDGKDVMQKVVCTVTNTGQCDGDEVVQLYINDKVSSVVTPPIR
LKGFEKIFLKKGESKDVTFVLTRKDLSIFDKNMQFTAEPGEFKVMVGGASNNLPLQGTFE
IK

Enzyme Prediction     

No EC number prediction in MGYG000002614_00232.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	124	350	2.3e-69	0.9814814814814815

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15098	PRK15098	0.0	1	781	1	764	beta-glucosidase BglX.
COG1472	BglX	8.53e-101	44	480	1	396	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
PLN03080	PLN03080	1.65e-96	127	741	78	742	Probable beta-xylosidase; Provisional
pfam00933	Glyco_hydro_3	1.01e-75	45	382	1	316	Glycosyl hydrolase family 3 N terminal domain.
pfam01915	Glyco_hydro_3_C	5.82e-70	420	665	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRO24329.1	0.0	1	782	1	787
QEW35133.1	0.0	19	779	23	783
QQY39447.1	0.0	19	779	25	785
ABR38266.1	0.0	19	779	23	783
ADV43485.1	0.0	1	781	1	781

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5Z87_A	1.22e-143	26	773	36	777	ChainA, EmGH1 [Aurantiacibacter marinus],5Z87_B Chain B, EmGH1 [Aurantiacibacter marinus]
5YOT_A	3.89e-139	22	782	3	757	Isoprimeverose-producingenzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YOT_B Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YQS_A Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YQS_B Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40]
7EAP_A	3.01e-138	22	782	3	757	ChainA, Fn3_like domain-containing protein [Aspergillus oryzae RIB40]
5XXL_A	3.11e-136	37	773	14	744	Crystalstructure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXL_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXM_A Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482],5XXM_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482]
6R5I_A	4.08e-136	34	767	4	719	ChainA, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5I_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5N_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5N_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q56078	2.71e-143	37	781	38	764	Periplasmic beta-glucosidase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=bglX PE=3 SV=2
P33363	2.13e-138	37	781	38	764	Periplasmic beta-glucosidase OS=Escherichia coli (strain K12) OX=83333 GN=bglX PE=3 SV=2
T2KMH0	2.57e-130	94	770	29	710	Beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22130 PE=1 SV=1
T2KMH9	3.76e-128	1	770	1	744	Putative beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22230 PE=2 SV=1
D5EY15	1.35e-86	107	770	26	849	Xylan 1,4-beta-xylosidase OS=Prevotella ruminicola (strain ATCC 19189 / JCM 8958 / 23) OX=264731 GN=xyl3A PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000277	0.999106	0.000174	0.000158	0.000137	0.000130

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002614_00232.