CAZyme Information: MGYG000002614_00233

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Phocaeicola
• CAZyme ID: MGYG000002614_00233
• CAZy Family: GH23
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
315	MGYG000002614_8|CGC1	36355.98	9.3221

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002614	2560607	MAG	China	Asia

• Gene Location: Start: 19033; End: 19980 Strand: +

Full Sequence      

MPWVIAALIGSMPFLLGNQLKEPSTQTVEKTLPLYSCLDVPAQFTLCDSTVDLSRYDRKE
RLDRELLAFSYMHSTSLQIIKRANRCFPIVEPILKQYGIPDDFKYLMVIESSLNPLARSG
AGAAGMWQFMEGTARDYGLEVSNTVDERYHLEKATHAACKYLKNAYRNYKSWMNVIASYN
AGQARISRQLLRQDVDDALDLYLVEETTRYPYRVMAAKMLLSEPQKFGFRLKASDLYPPI
HYREIKVSENIEDLARFARGQGINYSLLKNMNPWLRSTSLHVHKGKTYAIKIPAKESMYY
NSKVIIPHDKRWIVE

Enzyme Prediction     

No EC number prediction in MGYG000002614_00233.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	91	217	3.5e-20	0.837037037037037

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd16894	MltD-like	1.25e-58	94	219	1	129	Membrane-bound lytic murein transglycosylase D and similar proteins. Lytic transglycosylases (LT) catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc). Membrane-bound lytic murein transglycosylase D protein (MltD) family members may have one or more small LysM domains, which may contribute to peptidoglycan binding. Unlike the similar "goose-type" lysozymes, LTs also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria, the LTs in bacteriophage lambda, as well as the eukaryotic "goose-type" lysozymes (goose egg-white lysozyme; GEWL).
pfam01464	SLT	3.22e-23	95	190	6	103	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.
PRK10783	mltD	4.77e-20	70	273	92	293	membrane-bound lytic murein transglycosylase D; Provisional
cd00254	LT-like	6.31e-17	106	217	7	109	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd13403	MLTF-like	6.72e-15	95	186	6	99	membrane-bound lytic murein transglycosylase F (MLTF) and similar proteins. This subfamily includes membrane-bound lytic murein transglycosylase F (MltF, murein lyase F) that degrades murein glycan strands. It is responsible for catalyzing the release of 1,6-anhydromuropeptides from peptidoglycan. Lytic transglycosylase catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc) as do goose-type lysozymes. However, in addition, it also makes a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QEW35083.1	5.08e-145	8	315	16	332
QQY44628.1	5.08e-145	8	315	16	332
QRO24006.1	1.02e-144	2	315	10	322
QQY40386.1	2.06e-144	8	315	16	332
ABR38313.1	2.63e-144	8	315	23	339

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P0AEZ7	5.68e-20	59	297	78	312	Membrane-bound lytic murein transglycosylase D OS=Escherichia coli (strain K12) OX=83333 GN=mltD PE=1 SV=1
P0AEZ8	5.68e-20	59	297	78	312	Membrane-bound lytic murein transglycosylase D OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) OX=199310 GN=mltD PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.579985	0.418527	0.000917	0.000186	0.000160	0.000220

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002614_00233.