CAZyme Information: MGYG000002614_00652

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Phocaeicola
• CAZyme ID: MGYG000002614_00652
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
377	MGYG000002614_30|CGC1	42716.11	8.5187

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002614	2560607	MAG	China	Asia

• Gene Location: Start: 3748; End: 4881 Strand: -

Full Sequence      

MKYYLIVGEASGDLHASNLMKSVLQKDNDAQFRFFGGDLMKAVGGTLVKHYKDMAYMGFI
PVLLHLREIFGNMDLCKRDILRWQPDVVILVDYPGFNLKIAEFIKKKTSIPVYYYISPKI
WAWKEHRIHNIKHDVDELFSILPFEVDFFKKHDYPIHYIGNPCVDAVEAFKRSYTETMSE
FCARHALSDKPIVAVLAGSRKQEIKDNLSVMMHVVNKFPACQFVVAGAPAIDKEYYKAFL
PLHVKLVFGETYALLSHADAAIVTSGTATLETALFRVPQVVCYYTAAGKVVALLRKLLLK
VPYISLVNLIRGKKVVSELVADEMTALNVELELKALLNNKIYRQGVLDGYEEMAEILGPE
GASSRAAEIMVRLLRER

Enzyme Prediction     

No EC number prediction in MGYG000002614_00652.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	4	357	2.3e-109	0.9887005649717514

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00025	lpxB	1.04e-97	1	377	2	378	lipid-A-disaccharide synthase; Reviewed
COG0763	LpxB	1.38e-92	1	376	2	381	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
pfam02684	LpxB	9.34e-67	4	366	2	368	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
TIGR00215	lpxB	2.37e-54	5	368	10	380	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK14089	PRK14089	8.97e-42	1	370	2	344	lipid-A-disaccharide synthase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRO23865.1	5.60e-188	1	377	1	377
QQY38221.1	4.27e-183	1	376	1	379
QUT59470.1	4.27e-183	1	376	1	379
QQY41518.1	4.27e-183	1	376	1	379
ABR39591.1	4.27e-183	1	376	1	379

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8N_A	4.72e-34	5	373	11	380	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]
5W8S_A	4.72e-34	5	373	11	380	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q2LVL8	1.38e-65	5	376	8	380	Lipid-A-disaccharide synthase OS=Syntrophus aciditrophicus (strain SB) OX=56780 GN=lpxB PE=3 SV=1
Q1D393	1.00e-61	5	374	9	378	Lipid-A-disaccharide synthase OS=Myxococcus xanthus (strain DK1622) OX=246197 GN=lpxB PE=3 SV=1
Q39T49	1.03e-61	5	374	11	380	Lipid-A-disaccharide synthase OS=Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15) OX=269799 GN=lpxB PE=3 SV=1
Q6ALW0	2.15e-61	5	374	14	386	Lipid-A-disaccharide synthase OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) OX=177439 GN=lpxB PE=3 SV=1
Q3JAC1	2.36e-56	5	374	10	378	Lipid-A-disaccharide synthase OS=Nitrosococcus oceani (strain ATCC 19707 / BCRC 17464 / JCM 30415 / NCIMB 11848 / C-107) OX=323261 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000061	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002614_00652.