CAZyme Information: MGYG000002614_00892

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Phocaeicola
• CAZyme ID: MGYG000002614_00892
• CAZy Family: GH141
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
708		80591.15	7.2342

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002614	2560607	MAG	China	Asia

• Gene Location: Start: 4965; End: 7091 Strand: -

Full Sequence      

MKNLLFTALFAGMTLCVSAQKTVYVSPTGNDAYTGEQHRPFKTLNRAFVESENNRDTLYI
EVASGDYFLEKSLELSDRLNCPVVVRGDEKNKPRFLGGIKIQQWKKYRDGIYRAYVPEVK
CYGYQFEQFFVNGVRAIQARTPNKDWFYVKGYKEYPYVSGVRSANYATQKIMMDKQDLKS
LSGLSASELADIRFRFYHKWDITQKEVAYACPDSGFVYFHGGGMKPWNPISEGARYIMYG
YKAALDMPGEWYLDKAEGYVYYMPRTGENLETAECIVPTLHQWIVVKGKSGAVLKDIRFE
NLSFQYAAYSMPKFGDEPMQAAATVEAAVELEHANNVNFVNCEMQHTGGYAIWLKAACAD
NTIEHCYIADLGAGGIKIGSPWYTNDSTLISRRNVVNNSIITHAGSELPCGVGVAIFHAS
DNKVTHNEISDLRYSGVSVGWVWGYNNSYEIWTNVLMKDGTVDFAQVRLVSPAVRNLVAY
NHIHHIGWGELSDMGAVYTLGESHGTRIVNNIIHDVLSYDYGGWGLYTDEGSTGVEMSSN
LVYRCKSGGFHQHYGKENRIENNIFAFGHYYQAQYTRVEDHLSFHFRHNIILQDKGETLA
GPWENGKIDMDYNLYWHLDGEPQFGKHSFEEWKKLKEKHSVMMSPGFKDALNDDYSFATL
KAARKIHFKPFDLSKVGVYGSAEWKERAKMSAQQLDLFKEIAKVRLKK

Enzyme Prediction     

No EC number prediction in MGYG000002614_00892.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH141	22	543	3e-94	0.9905123339658444

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam13229	Beta_helix	1.12e-11	350	563	1	156	Right handed beta helix region. This region contains a parallel beta helix region that shares some similarity with Pectate lyases.
pfam13229	Beta_helix	2.02e-10	331	439	28	120	Right handed beta helix region. This region contains a parallel beta helix region that shares some similarity with Pectate lyases.
pfam13229	Beta_helix	1.26e-06	331	427	74	155	Right handed beta helix region. This region contains a parallel beta helix region that shares some similarity with Pectate lyases.
pfam13229	Beta_helix	5.45e-06	413	565	2	110	Right handed beta helix region. This region contains a parallel beta helix region that shares some similarity with Pectate lyases.
pfam05048	NosD	3.69e-05	382	575	25	181	Periplasmic copper-binding protein (NosD). NosD is a periplasmic protein which is thought to insert copper into the exported reductase apoenzyme (NosZ). This region forms a parallel beta helix domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGA25764.1	7.78e-197	1	693	1	677
AEL24383.1	9.90e-195	4	698	14	703
AKP49975.1	4.49e-193	21	708	36	713
SCM58138.1	1.19e-184	9	703	9	702
AWO00314.1	1.56e-180	18	705	32	700

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MQP_A	3.51e-40	23	540	27	580	Glycosidehydrolase BT_1002 [Bacteroides thetaiotaomicron],5MQP_B Glycoside hydrolase BT_1002 [Bacteroides thetaiotaomicron],5MQP_C Glycoside hydrolase BT_1002 [Bacteroides thetaiotaomicron],5MQP_D Glycoside hydrolase BT_1002 [Bacteroides thetaiotaomicron],5MQP_E Glycoside hydrolase BT_1002 [Bacteroides thetaiotaomicron],5MQP_F Glycoside hydrolase BT_1002 [Bacteroides thetaiotaomicron],5MQP_G Glycoside hydrolase BT_1002 [Bacteroides thetaiotaomicron],5MQP_H Glycoside hydrolase BT_1002 [Bacteroides thetaiotaomicron]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.001165	0.649432	0.348584	0.000298	0.000265	0.000246

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002614_00892.