CAZyme Information: MGYG000002614_01259

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Phocaeicola
• CAZyme ID: MGYG000002614_01259
• CAZy Family: GH141
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
724		82097.51	5.8206

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002614	2560607	MAG	China	Asia

• Gene Location: Start: 7783; End: 9957 Strand: -

Full Sequence      

MTYRARHEGKAIISGGQQVKLNWKREPGNIYVAKVPASVVIDQLYVDNMKQQMARFPNAQ
PGQGRNVYDTWVLDHNAQPDPDMDPLQPERVSHWTHPEGGYVHAMHTALWGDMHWEIKGV
NEDGTLQLEGGWQNNRPSGMHPVYRFVENIKEELDEPGEWYYDRLASQIHYMPYPEMDID
DAHVEIVRLKHLIEFNGSKASPVQGINLEGFTFKHTVRTFMENKEQLLRSDWTVYRGGAV
VYNGAKDCRIENCEFDHVGGNTIFVNNYNRYITIRGCYIHHSGANGIAFVGDPNMVRSPL
FRYGDQNYEAMDKTPGPLGDNYPQDCTVDDCLITMTGRDEKQTAPVQISMSQRIRVSHCS
IYDVPRAGININEGTFGGHIIEFCDVFNTVLETGDHGSFNSWGRDRFWTPDVVTISNQVA
MRPDMSYWDMLEPNVLRYNRWRCDHGWDVDLDDGSSHYRIYCNLMLNGGLKLREGYDRIA
TNNIILNNSLHPHVWLRNSGDVFKHNIVFTAYQPAVMHSALGESDRWGEELDCNLFATSR
SAMEKFAVNEADMHSLSADPLFTDAAKGDFTVKPESPALKIGFRNFSMTDFGVRSKKLKQ
LAKTPEIPKVTMQFSVIATTEYAWMGAILKEVQGEQLSAYGAKFGQAGVAFELVPSDSEA
YKLGFRTGDLLLQFNGQPTPTAIAINSLLNKWTGKSCELVIMRNQKETILNLSQLGDQLM
PTIE

Enzyme Prediction     

No EC number prediction in MGYG000002614_01259.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH141	2	374	1.7e-46	0.715370018975332

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam13229	Beta_helix	9.09e-11	237	388	23	136	Right handed beta helix region. This region contains a parallel beta helix region that shares some similarity with Pectate lyases.
cd00987	PDZ_serine_protease	5.36e-06	623	712	1	90	PDZ domain of trypsin-like serine proteases, such as DegP/HtrA, which are oligomeric proteins involved in heat-shock response, chaperone function, and apoptosis. May be responsible for substrate recognition and/or binding, as most PDZ domains bind C-terminal polypeptides, though binding to internal (non-C-terminal) polypeptides and even to lipids has been demonstrated. In this subfamily of protease-associated PDZ domains a C-terminal beta-strand forms the peptide-binding groove base, a circular permutation with respect to PDZ domains found in Eumetazoan signaling proteins.
pfam17161	DUF5123	4.58e-05	534	582	63	112	Domain of unknown function (DUF5123).
pfam17820	PDZ_6	1.67e-04	657	703	8	54	PDZ domain. This entry represents the PDZ domain from a wide variety of proteins.
cd00989	PDZ_metalloprotease	1.92e-04	652	707	18	72	PDZ domain of bacterial and plant zinc metalloprotases, presumably membrane-associated or integral membrane proteases, which may be involved in signalling and regulatory mechanisms. May be responsible for substrate recognition and/or binding, as most PDZ domains bind C-terminal polypeptides, and binding to internal (non-C-terminal) polypeptides and even to lipids has been demonstrated. In this subfamily of protease-associated PDZ domains a C-terminal beta-strand forms the peptide-binding groove base, a circular permutation with respect to PDZ domains found in Eumetazoan signaling proteins.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AWW32784.1	2.88e-182	1	639	102	725
AFZ35556.1	1.14e-35	1	594	128	711
QNN21980.1	5.56e-29	43	592	133	672
QWX84986.1	1.40e-28	1	594	101	710
QHT69676.1	1.26e-26	1	597	96	691

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000040	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002614_01259.