CAZyme Information: MGYG000002614_01501

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Phocaeicola
• CAZyme ID: MGYG000002614_01501
• CAZy Family: GH16
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
282	MGYG000002614_113|CGC1	32731.55	5.6054

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002614	2560607	MAG	China	Asia

• Gene Location: Start: 4702; End: 5550 Strand: +

Full Sequence      

MKRFYWGALALSLGLSGCTSNVVKNNHPAPFGVPEASNWVYSELISDEFDDAVLDTAKWF
DHNPTWMGRQPSLFRKENVRVENGQLILSGKREEVKDAPEGYHTFTSAAVQSKKKVLYGF
FEIKCKAMNSALSSAFWLYVQDSIKQEEIDIFEICGRHDSSPSYPKTYFATSHYIIKTHN
LQISDHVEHIGEQPWAERYFVAGFKWTRDELVWYVDGKEIRRRKNDFWHSPETINFDSEA
FPSWWGLPSETDNGGEFQIEYFRYWSEPDASNGKTVFVNDMK

Enzyme Prediction     

No EC number prediction in MGYG000002614_01501.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH16	46	265	6.9e-79	0.9955357142857143

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd02178	GH16_beta_agarase	1.23e-53	34	265	14	257	Beta-agarase, member of glycosyl hydrolase family 16. Beta-agarase is a glycosyl hydrolase family 16 (GH16) member that hydrolyzes the internal beta-1,4-linkage of agarose, a hydrophilic polysaccharide found in the cell wall of Rhodophyceaea, marine red algae. Agarose is a linear chain of galactose units linked by alternating L-alpha-1,3- and D-beta-1,4-linkages that are additionally modified by a 3,6-anhydro-bridge. Agarose forms thermo-reversible gels that are widely used in the food industry or as a laboratory medium. While beta-agarases are also found in two other families derived from the sequence-based classification of glycosyl hydrolases (GH50, and GH86) the GH16 members are most abundant. This domain adopts a curved beta-sandwich conformation, with a tunnel-shaped active site cavity, referred to as a jellyroll fold.
cd00413	Glyco_hydrolase_16	2.06e-26	47	265	1	210	glycosyl hydrolase family 16. The O-Glycosyl hydrolases are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A glycosyl hydrolase classification system based on sequence similarity has led to the definition of more than 95 different families inlcuding glycosyl hydrolase family 16. Family 16 includes lichenase, xyloglucan endotransglycosylase (XET), beta-agarase, kappa-carrageenase, endo-beta-1,3-glucanase, endo-beta-1,3-1,4-glucanase, and endo-beta-galactosidase, all of which have a conserved jelly roll fold with a deep active site channel harboring the catalytic residues.
cd08023	GH16_laminarinase_like	4.97e-24	46	265	2	235	Laminarinase, member of the glycosyl hydrolase family 16. Laminarinase, also known as glucan endo-1,3-beta-D-glucosidase, is a glycosyl hydrolase family 16 member that hydrolyzes 1,3-beta-D-glucosidic linkages in 1,3-beta-D-glucans such as laminarins, curdlans, paramylons, and pachymans, with very limited action on mixed-link (1,3-1,4-)-beta-D-glucans.
cd02177	GH16_kappa_carrageenase	2.66e-13	39	265	8	268	Kappa-carrageenase, member of glycosyl hydrolase family 16. Kappa-carrageenase is a glycosyl hydrolase family 16 (GH16) member that hydrolyzes the internal beta-1,4-linkage of kappa-carrageenans, a hydrophilic polysaccharide found in the cell wall of Rhodophyceaea, marine red algae. Carrageenans are linear chains of galactose units linked by alternating D-alpha-1,3- and D-beta-1,4-linkages that are additionally modified by a 3,6-anhydro-bridge. Depending on the position and number of sulfate ester modifications they are subdivided into kappa-, iota-, and lambda-carrageenases, kappa being modified once. Carrageenans form thermo-reversible gels widely used for industrial applications. Kappa-carrageenases exist in bacteria belonging to at least three phylogenetically distant branches, including pseudoalteromonas, planctomycetes, and baceroidetes. This domain adopts a curved beta-sandwich conformation, with a tunnel-shaped active site cavity, referred to as a jellyroll fold.
pfam00722	Glyco_hydro_16	7.04e-12	74	226	1	131	Glycosyl hydrolases family 16.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRO23370.1	3.41e-156	18	282	19	284
CDN31368.1	7.97e-127	28	266	25	262
QZE15408.1	3.46e-86	15	270	17	266
QZT35647.1	9.52e-86	38	267	32	262
ADE53088.1	1.06e-71	34	267	21	253

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4ATE_A	7.20e-21	39	242	18	226	Highresolution crystal structure of beta-porphyranase A from Zobellia galactanivorans [Zobellia galactanivorans]
3ILF_A	2.64e-19	39	242	20	228	Crystalstructure of porphyranase A (PorA) in complex with neo-porphyrotetraose [Zobellia galactanivorans]
3JUU_A	1.26e-15	39	218	27	221	Crystalstructure of porphyranase B (PorB) from Zobellia galactanivorans [Zobellia galactanivorans],3JUU_B Crystal structure of porphyranase B (PorB) from Zobellia galactanivorans [Zobellia galactanivorans]
5OCR_A	8.89e-15	39	234	21	235	Crystalstructure of the kappa-carrageenase zobellia_236 from Zobellia galactanivorans [Zobellia galactanivorans],5OCR_B Crystal structure of the kappa-carrageenase zobellia_236 from Zobellia galactanivorans [Zobellia galactanivorans],5OCR_C Crystal structure of the kappa-carrageenase zobellia_236 from Zobellia galactanivorans [Zobellia galactanivorans],5OCR_D Crystal structure of the kappa-carrageenase zobellia_236 from Zobellia galactanivorans [Zobellia galactanivorans]
4AWD_A	1.26e-14	34	218	43	260	ChainA, BETA-PORPHYRANASE [Phocaeicola plebeius],4AWD_B Chain B, BETA-PORPHYRANASE [Phocaeicola plebeius]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
D7GXG3	9.79e-22	34	218	24	216	Beta-porphyranase E OS=Zobellia galactanivorans (strain DSM 12802 / CCUG 47099 / CIP 106680 / NCIMB 13871 / Dsij) OX=63186 GN=porE PE=3 SV=1
D7GXG2	1.93e-20	20	251	27	273	Beta-porphyranase D OS=Zobellia galactanivorans (strain DSM 12802 / CCUG 47099 / CIP 106680 / NCIMB 13871 / Dsij) OX=63186 GN=porD PE=3 SV=1
D7GXG0	3.20e-19	39	242	29	237	Beta-porphyranase A OS=Zobellia galactanivorans (strain DSM 12802 / CCUG 47099 / CIP 106680 / NCIMB 13871 / Dsij) OX=63186 GN=porA PE=1 SV=1
D7GXF9	8.01e-15	39	218	40	234	Beta-porphyranase B OS=Zobellia galactanivorans (strain DSM 12802 / CCUG 47099 / CIP 106680 / NCIMB 13871 / Dsij) OX=63186 GN=porB PE=1 SV=1
B5CY92	6.75e-14	34	218	40	257	Beta-porphyranase B OS=Phocaeicola plebeius (strain DSM 17135 / JCM 12973 / M2) OX=484018 GN=BACPLE_01689 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000000	1.000066	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002614_01501.