CAZyme Information: MGYG000002619_02411

Basic Information

• Species: Faecalibacterium prausnitzii_J
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; Faecalibacterium; Faecalibacterium prausnitzii_J
• CAZyme ID: MGYG000002619_02411
• CAZy Family: CE8
• CAZyme Description: Pectinesterase A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
321		34284.71	5.425

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002619	2724245	MAG	China	Asia

• Gene Location: Start: 70666; End: 71631 Strand: -

Full Sequence      

MLTINVAPDGSGQFTTISEAVLAVPYDCPAVIRIAPGIYREKLVCEKKDITLAGAGMDAT
RLVWNDGGKLPHPDGRPTHTFRSYTAFFSGEKLRVEDMTIENDAGPGAKAGQAIAAYVDS
ARAVFSRVRLLGNQDTLFCAPLPEKEREKDGFLGPRVLAPRRASAQYYHACEIAGDIDFI
FGGAEALFEHCTLRTVDNGLAHSWVTAPSGAADGLGFVFWDCDFVSDCPAGSVYLGRPWR
PTGKTAVLDCRLGAHIAPEGFAGWNDRTDTALAGFAEAGSTGAGAGERPGWVQALSAAEA
AALLRAARQKCRMETTERITE

Enzyme Prediction     

No EC number prediction in MGYG000002619_02411.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	4	303	9.7e-77	0.9652777777777778

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4677	PemB	2.43e-53	6	285	87	379	Pectin methylesterase and related acyl-CoA thioesterases [Carbohydrate transport and metabolism, Lipid transport and metabolism].
pfam01095	Pectinesterase	8.81e-51	6	286	4	267	Pectinesterase.
PLN02773	PLN02773	9.73e-45	4	291	7	278	pectinesterase
PLN02745	PLN02745	1.49e-38	6	285	289	551	Putative pectinesterase/pectinesterase inhibitor
PLN02682	PLN02682	3.13e-37	2	291	69	343	pectinesterase family protein

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AXB27671.1	2.15e-235	1	321	1	321
CBL01447.1	2.15e-235	1	321	1	321
AXA81880.1	2.70e-182	1	315	1	315
CBK98674.1	1.82e-180	1	315	1	315
QIA44050.1	1.55e-178	1	312	1	312

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1XG2_A	2.18e-26	6	286	7	270	ChainA, Pectinesterase 1 [Solanum lycopersicum]
1GQ8_A	7.73e-24	6	285	11	273	Pectinmethylesterase from Carrot [Daucus carota]
3UW0_A	6.47e-22	4	242	35	272	Pectinmethylesterase from Yersinia enterocolitica [Yersinia enterocolitica subsp. enterocolitica 8081]
2NSP_A	1.56e-17	14	256	18	276	ChainA, Pectinesterase A [Dickeya dadantii 3937],2NSP_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NST_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NST_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT6_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT6_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT9_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT9_B Chain B, Pectinesterase A [Dickeya dadantii 3937]
1QJV_A	4.40e-14	14	256	18	276	ChainA, PECTIN METHYLESTERASE [Dickeya chrysanthemi],1QJV_B Chain B, PECTIN METHYLESTERASE [Dickeya chrysanthemi]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9LVQ0	7.35e-36	4	300	7	287	Pectinesterase 31 OS=Arabidopsis thaliana OX=3702 GN=PME31 PE=1 SV=1
Q43062	4.82e-29	6	265	211	454	Pectinesterase/pectinesterase inhibitor PPE8B OS=Prunus persica OX=3760 PE=2 SV=1
Q8VYZ3	5.04e-28	12	300	94	366	Probable pectinesterase 53 OS=Arabidopsis thaliana OX=3702 GN=PME53 PE=2 SV=1
Q8GXA1	7.72e-28	6	287	260	525	Probable pectinesterase/pectinesterase inhibitor 23 OS=Arabidopsis thaliana OX=3702 GN=PME23 PE=2 SV=3
Q9SMY6	1.23e-27	5	272	298	547	Putative pectinesterase/pectinesterase inhibitor 45 OS=Arabidopsis thaliana OX=3702 GN=PME45 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000071	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002619_02411.