CAZyme Information: MGYG000002620_00516

Basic Information

• Species: Desulfovibrio desulfuricans
• Lineage: Bacteria; Desulfobacterota; Desulfovibrionia; Desulfovibrionales; Desulfovibrionaceae; Desulfovibrio; Desulfovibrio desulfuricans
• CAZyme ID: MGYG000002620_00516
• CAZy Family: GH18
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
344		36907.17	8.8433

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002620	3478150	MAG	China	Asia

• Gene Location: Start: 253060; End: 254094 Strand: +

Full Sequence      

MKCLRSTASAGLLVLCCAFPAVAADAWVADWDMPNGLAELRQGNFKNALMFAAYFDRQGR
PFLTDDMKKALRGGLGTSLGQSSNKAQGVFLSVVNDVVEAPGKSVQKDPSLVSRLMATDA
SRAAHRSDLLALLTAYPFTGLELDYERVSMDDWPRLLTFAQELSTTLAAQGKKLRLVMEP
KQKYLQGNLPAGPQYVVMAYNLHGSHNGPGAKADDAFLRQLAQWCAHWPVKPGLALSAGG
FAWTGRGVVELTERKAAAWAQGAGVQPKRDPASHALYFKAADNTPGSPLLTKGGINGSIC
EIWYADGETLAHWADVGRSLGFGDVSLWRLGGNTPESLAKISGK

Enzyme Prediction     

No EC number prediction in MGYG000002620_00516.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	105	335	1e-15	0.7195945945945946

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06549	GH18_trifunctional	5.19e-35	81	335	53	295	GH18 domain of an uncharacterized family of bacterial proteins, which share a common three-domain architecture: an N-terminal glycosyl hydrolase family 18 (GH18) domain, a glycosyl transferase family 2 domain, and a C-terminal polysaccharide deacetylase domain.
cd02874	GH18_CFLE_spore_hydrolase	2.80e-13	108	331	74	303	Cortical fragment-lytic enzyme (CFLE) is a peptidoglycan hydrolase involved in bacterial endospore germination. CFLE is expressed as an inactive preprotein (called SleB) in the forespore compartment of sporulating cells. SleB translocates across the forespore inner membrane and is deposited as a mature enzyme in the cortex layer of the spore. As part of a sensory mechanism capable of initiating germination, CFLE degrades a spore-specific peptidoglycan constituent called muramic-acid delta-lactam that comprises the outer cortex. CFLE has a C-terminal glycosyl hydrolase family 18 (GH18) catalytic domain as well as two N-terminal LysM peptidoglycan-binding domains. In addition to SleB, this family includes YaaH, YdhD, and YvbX from Bacillus subtilis.
COG3858	YaaH	1.45e-08	108	344	178	421	Spore germination protein YaaH [Cell cycle control, cell division, chromosome partitioning].
pfam00704	Glyco_hydro_18	6.12e-07	113	332	80	306	Glycosyl hydrolases family 18.
smart00636	Glyco_18	2.16e-04	113	209	83	193	Glyco_18 domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QTO41708.1	2.84e-237	1	344	1	340
AWP30943.1	1.75e-70	26	342	41	345
AVV60320.1	3.48e-70	26	342	41	345
ANA81893.1	4.02e-70	26	342	46	350
AYB45334.1	4.51e-70	26	343	48	353

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000625	0.822711	0.175860	0.000276	0.000271	0.000233

TMHMM  Annotations     

start	end
7	29