CAZyme Information: MGYG000002621_00483

Basic Information

• Species: Bacteroides ndongoniae
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides ndongoniae
• CAZyme ID: MGYG000002621_00483
• CAZy Family: CE1
• CAZyme Description: Carbohydrate acetyl esterase/feruloyl esterase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
291	MGYG000002621_3|CGC4	33020.75	6.2923

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002621	3633256	MAG	China	Asia

• Gene Location: Start: 186432; End: 187307 Strand: -

Full Sequence      

MKKILIALFVCLGGCALLHAQGFPQSRIVTDTIYSEVLQAKRAYTVFLPLSFDMDTQKQY
PVLYLLHGMWENNSVWANRGHVKDVMDRLTASGEACEMIIVTPDAGGGNPEVFQNGYFDM
PGWKYETFFYTEFLPFIEKKYRVIGDKQHRAIAGLSMGGGGATVYGQHHTDMFCAVYAMS
ALMSIPEQGAARYDNPDGKLGILTRSVIENSSVDYVLKADESRKANLRSVAWYVDCGDDD
FLLDRNIEFYQAMRNAGIPCQFRVRDGGHDWEYWHSALYQCLPFVSRMFLR

Enzyme Prediction     

No EC number prediction in MGYG000002621_00483.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE1	35	286	2.6e-56	0.9823788546255506

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0627	FrmB	1.34e-28	43	287	36	310	S-formylglutathione hydrolase FrmB [Defense mechanisms].
pfam00756	Esterase	1.87e-27	35	284	1	245	Putative esterase. This family contains Esterase D. However it is not clear if all members of the family have the same function. This family is related to the pfam00135 family.
COG2382	Fes	2.30e-20	28	282	68	292	Enterochelin esterase or related enzyme [Inorganic ion transport and metabolism].
COG4947	COG4947	6.85e-08	152	278	105	223	Esterase/lipase superfamily enzyme [General function prediction only].
COG2819	YbbA	2.64e-06	42	287	21	260	Predicted hydrolase of the alpha/beta superfamily [General function prediction only].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ABR43742.1	1.01e-33	5	287	114	389
QJE30861.1	1.01e-33	5	287	114	389
BBK92061.1	1.01e-33	5	287	114	389
QIX63945.1	1.01e-33	5	287	114	389
QUR47296.1	1.01e-33	5	287	114	389

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5VOL_A	2.22e-167	25	289	9	272	Bacint_04212ferulic acid esterase [Bacteroides intestinalis DSM 17393],5VOL_B Bacint_04212 ferulic acid esterase [Bacteroides intestinalis DSM 17393],5VOL_C Bacint_04212 ferulic acid esterase [Bacteroides intestinalis DSM 17393],5VOL_D Bacint_04212 ferulic acid esterase [Bacteroides intestinalis DSM 17393],5VOL_E Bacint_04212 ferulic acid esterase [Bacteroides intestinalis DSM 17393],5VOL_F Bacint_04212 ferulic acid esterase [Bacteroides intestinalis DSM 17393],5VOL_G Bacint_04212 ferulic acid esterase [Bacteroides intestinalis DSM 17393],5VOL_H Bacint_04212 ferulic acid esterase [Bacteroides intestinalis DSM 17393]
6RZN_A	1.26e-27	19	287	123	386	Crystalstructure of the N-terminal carbohydrate binding module family 48 and ferulic acid esterase from the multi-enzyme CE1-GH62-GH10 [uncultured bacterium],6RZN_B Crystal structure of the N-terminal carbohydrate binding module family 48 and ferulic acid esterase from the multi-enzyme CE1-GH62-GH10 [uncultured bacterium]
1JJF_A	6.64e-24	22	286	26	258	ChainA, Endo-1,4-beta-xylanase Z [Acetivibrio thermocellus]
7B5V_A	7.45e-24	19	280	130	379	ChainA, Carbohydrate Esterase family 1 protein with an N-terminal carbohydrate binding module family 48 [Dysgonomonas mossii DSM 22836],7B5V_B Chain B, Carbohydrate Esterase family 1 protein with an N-terminal carbohydrate binding module family 48 [Dysgonomonas mossii DSM 22836],7B6B_A Chain A, Carbohydrate Esterase family 1 protein with an N-terminal carbohydrate binding module family 48 [Dysgonomonas mossii DSM 22836],7B6B_B Chain B, Carbohydrate Esterase family 1 protein with an N-terminal carbohydrate binding module family 48 [Dysgonomonas mossii DSM 22836]
1JT2_A	1.78e-23	22	286	26	258	ChainA, PROTEIN (ENDO-1,4-BETA-XYLANASE Z) [Acetivibrio thermocellus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
D5EXZ4	2.66e-24	21	287	424	670	Carbohydrate acetyl esterase/feruloyl esterase OS=Prevotella ruminicola (strain ATCC 19189 / JCM 8958 / 23) OX=264731 GN=axe1-6A PE=1 SV=1
P10478	6.79e-22	22	286	45	277	Endo-1,4-beta-xylanase Z OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=xynZ PE=1 SV=3
P23553	9.08e-15	28	288	3	264	Acetyl esterase OS=Caldicellulosiruptor saccharolyticus OX=44001 GN=xynC PE=4 SV=1
P31471	1.88e-14	18	196	133	322	Uncharacterized protein YieL OS=Escherichia coli (strain K12) OX=83333 GN=yieL PE=4 SV=3
D5EY13	2.60e-12	19	278	491	717	Endo-1,4-beta-xylanase/feruloyl esterase OS=Prevotella ruminicola (strain ATCC 19189 / JCM 8958 / 23) OX=264731 GN=xyn10D-fae1A PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000612	0.632095	0.366475	0.000276	0.000282	0.000242

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002621_00483.