CAZyme Information: MGYG000002621_00688

Basic Information

• Species: Bacteroides ndongoniae
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides ndongoniae
• CAZyme ID: MGYG000002621_00688
• CAZy Family: GH105
• CAZyme Description: Unsaturated rhamnogalacturonyl hydrolase YteR

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
405	MGYG000002621_5|CGC1	46839.53	8.2383

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002621	3633256	MAG	China	Asia

• Gene Location: Start: 13124; End: 14341 Strand: +

Full Sequence      

MKNSIICKILVCSLWMVFPWGMSAQKVSDKQPWSVRMAESEMIRCPESWQLDFQPKLKWD
YCHGLELQSMLDVYDRYGDRKFYDYALAYADTMVNADGTIKMYKRQEFSLDRVNSGKFLF
RIYEQTKDEKYRKALDLLRSQFDEHPRNADGGFWHKKIYPNQVWLDGVYMGAPFYAEYAF
RNNQVEVYPDVVNQFLMAARHTYDPANGLYRHACDVSRKERWADPVTGQSQHCWGRALGW
YAMAFVDALDFIPKHEAGRDSMLVIFNNIAAQVKRLQDSKTGVWYQVLDKSGAKGNYLES
SCSAMFVYALFKGVRKGYIDPSYLEVAVKGYKGILKEFIRVDKDGLVSITQACAVAGLGG
KNYRSGDYDYYINETIRDNDAKAVGPFILASLEWERLQEVKAIVK

Enzyme Prediction     

EC	3.2.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	52	396	4.9e-122	0.9819277108433735

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07470	Glyco_hydro_88	7.30e-129	33	398	1	343	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.
COG4225	YesR	4.15e-104	53	397	28	356	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRQ48639.1	2.03e-260	1	404	1	404
QUT45768.1	5.83e-260	1	404	1	404
AVM56437.1	5.11e-257	1	404	1	405
QDO69177.1	1.03e-255	1	404	1	403
QUT93209.1	5.97e-255	1	404	1	403

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WU0_A	1.34e-117	59	397	23	361	StructuralAnalysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824],4WU0_B Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824]
1NC5_A	6.06e-86	21	397	2	367	Structureof Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	5.02e-85	52	397	22	357	ChainA, Putative glycosyl hydrolase yteR [Bacillus subtilis]
3K11_A	2.52e-23	137	397	169	413	Crystalstructure of Putative glycosyl hydrolase (NP_813087.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 1.80 A resolution [Bacteroides thetaiotaomicron VPI-5482]
4XUV_A	3.44e-18	42	335	30	321	Crystalstructure of a glycoside hydrolase family 105 (GH105) enzyme from Thielavia terrestris [Thermothielavioides terrestris NRRL 8126],4XUV_B Crystal structure of a glycoside hydrolase family 105 (GH105) enzyme from Thielavia terrestris [Thermothielavioides terrestris NRRL 8126]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O34559	3.32e-85	21	397	2	367	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1
P0A3U6	6.88e-46	170	393	1	227	Protein Atu3128 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) OX=176299 GN=Atu3128 PE=3 SV=1
P0A3U7	6.88e-46	170	393	1	227	24.9 kDa protein in picA locus OS=Rhizobium radiobacter OX=358 PE=2 SV=1
L7P9J4	2.02e-07	164	334	161	330	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Nonlabens ulvanivorans OX=906888 GN=IL45_01505 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000212	0.999217	0.000157	0.000147	0.000134	0.000122

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002621_00688.