CAZyme Information: MGYG000002621_01578

Basic Information

• Species: Bacteroides ndongoniae
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides ndongoniae
• CAZyme ID: MGYG000002621_01578
• CAZy Family: GH3
• CAZyme Description: Beta-hexosaminidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
942	MGYG000002621_14|CGC2	104691.29	5.0221

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002621	3633256	MAG	China	Asia

• Gene Location: Start: 61058; End: 63886 Strand: +

Full Sequence      

MNKLFIATLLLSGSTFLSGQTVPRIPETYKPSKSEMYHKGWIDFNKNGVKDVYEDPSAPV
EARIENLLGQMTLEEKTCQMVTLYGYKRVLKDDLPTAEWKKSLWKDGIGAIDEHLNGFQQ
WGLPPSDNPYVWPASRHAWALNEVQRFFVEETRLGIPTDFTNEGIRGIESFRATNFPTQL
GLGHTWNRKLIHQVGLITGREARMLGYTNVYAPILDVGRDQRWGRYEEVYGESPYLVAEL
GIEMVRGLQHNHQVTSTGKHFVAYSNNKGAREGMARVDPQMSPREVENVHVYPFRRVIQE
AGMLGIMSSYNDYDGFPIQGSYYWLTTRLRGEMGFRGYVVSDSDAVEYLYTKHGTAKDMK
EAVRQSVEAGLNVRCTFRSPESFVYPLRELVKEGGLSEELINDRVRDILRVKFLVGLFDS
PYQTDLAGADKEVEKAENEAIALQASRESIVLLKNESEVLPLDINQIKRIAVCGPNADEE
GYALTHYGPLAVDVTTVLEGIQAKVEGRAEVVYTKGCELVDAHWPESELIDYPLTAEEQA
EIDRAVENACQSDVAVVVLGGGQRTCGENKSRSSLDLPGRQLQLLQAVQATGKPVVLILI
NGRPLSINWADKFVPAILEAWYPGSKGGTALADILFGDYNPGGKLTVTFPKSVGQIPFNF
PCKPSSQVDGGQNMGPDGNMTRVNGALYPFGYGLSYTTFEYSDLEISPKVITPNERVQVS
LKVTNTGKRAGDEVVQLYTRDVISSVTTYEKNLAGFERIHLRPGETQTVTFTLDRKHLEL
LNADMKWVVEPGEFSIMAGASSEDIRLSGMLQVEEYATRLQAIEAQKTQSPVTASTNPES
TSLVLDGKADTSWQGNKGDYITLSLDNSPHVEKVDITFTRENNLPAEFEIQLSGGGGQFL
TVYSGTVSEYGKAITYKFKGSTASDLRIVLKDDRVGVAEIKL

Enzyme Prediction     

No EC number prediction in MGYG000002621_01578.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	150	375	2.1e-62	0.9814814814814815

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15098	PRK15098	0.0	51	806	22	758	beta-glucosidase BglX.
PLN03080	PLN03080	5.74e-98	55	799	44	769	Probable beta-xylosidase; Provisional
COG1472	BglX	9.68e-76	137	519	41	397	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
pfam01915	Glyco_hydro_3_C	3.69e-70	450	696	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
pfam00933	Glyco_hydro_3	1.37e-62	72	411	1	316	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT34231.1	0.0	1	941	1	941
QUT62569.1	0.0	1	941	1	941
QQA31118.1	0.0	1	941	1	941
BBK89234.1	0.0	1	941	1	941
QUT68890.1	0.0	1	941	1	941

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5XXL_A	4.79e-127	141	806	69	745	Crystalstructure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXL_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXM_A Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482],5XXM_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482]
5YOT_A	7.66e-127	50	814	4	757	Isoprimeverose-producingenzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YOT_B Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YQS_A Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YQS_B Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40]
5XXN_A	2.58e-126	141	806	69	745	CrystalStructure of mutant (D286N) beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorose [Bacteroides thetaiotaomicron VPI-5482],5XXN_B Crystal Structure of mutant (D286N) beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorose [Bacteroides thetaiotaomicron VPI-5482],5XXO_A Crystal structure of mutant (D286N) GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorotriose [Bacteroides thetaiotaomicron VPI-5482],5XXO_B Crystal structure of mutant (D286N) GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorotriose [Bacteroides thetaiotaomicron VPI-5482]
7EAP_A	5.78e-126	50	814	4	757	ChainA, Fn3_like domain-containing protein [Aspergillus oryzae RIB40]
5Z87_A	3.12e-122	47	806	30	778	ChainA, EmGH1 [Aurantiacibacter marinus],5Z87_B Chain B, EmGH1 [Aurantiacibacter marinus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KMH0	2.00e-140	153	803	62	711	Beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22130 PE=1 SV=1
P33363	1.13e-131	141	806	89	758	Periplasmic beta-glucosidase OS=Escherichia coli (strain K12) OX=83333 GN=bglX PE=3 SV=2
Q56078	1.80e-129	141	806	89	758	Periplasmic beta-glucosidase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=bglX PE=3 SV=2
T2KMH9	7.61e-123	1	806	1	748	Putative beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22230 PE=2 SV=1
A7LXU3	3.16e-96	55	805	32	768	Beta-glucosidase BoGH3B OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02659 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000678	0.998244	0.000484	0.000214	0.000182	0.000164

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002621_01578.