CAZyme Information: MGYG000002622_01309

Basic Information

• Species: Phocaeicola sp900546095
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Phocaeicola; Phocaeicola sp900546095
• CAZyme ID: MGYG000002622_01309
• CAZy Family: CBM32
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
282	MGYG000002622_10|CGC1	31477.98	4.1181

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002622	3429958	MAG	China	Asia

• Gene Location: Start: 21898; End: 22746 Strand: -

Full Sequence      

MKKLSYLMLFFLSAFLLGGCADTEQPYVGYITIKRAVVEAAANSTATITADTDIDSPIEL
KSIDFGEGVEEWCTVAFNGRDITVTATQANTGDNYRTATVNVKCGYWQTSFTVLQKYEGQ
EYLQYDWTGWTATGSDVQENDGGGYSSLFTEDRTEFWHSYYGEPTPCPHWLLIDMQKELE
CSRFAIGRREAGGNNYPSVRHMNIYVSTDGENFEQVGEFTFELPWTAPDGTVVEGNSPLV
PAEEVITLDAPVTARYVRLEITATNNDTGVCQVAYCKVYEKL

Enzyme Prediction     

No EC number prediction in MGYG000002622_01309.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CBM32	139	268	2.5e-16	0.8306451612903226

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00754	F5_F8_type_C	1.19e-14	138	274	7	125	F5/8 type C domain. This domain is also known as the discoidin (DS) domain family.
cd00057	FA58C	1.50e-09	152	266	32	133	Substituted updates: Jan 31, 2002
pfam13004	BACON	6.13e-05	62	116	1	61	Putative binding domain, N-terminal. The BACON (Bacteroidetes-Associated Carbohydrate-binding Often N-terminal) domain is an all-beta domain found in diverse architectures, principally in combination with carbohydrate-active enzymes and proteases. These architectures suggest a carbohydrate-binding function which is also supported by the nature of BACON's few conserved amino-acids. The phyletic distribution of BACON and other data tentatively suggest that it may frequently function to bind mucin. Further work with the characterized structure of a member of glycoside hydrolase family 5 enzyme, Structure 3ZMR, has found no evidence for carbohydrate-binding for this domain.
cd14948	BACON	1.06e-04	70	116	34	83	Bacteroidetes-Associated Carbohydrate-binding (putative) Often N-terminal (BACON) domain. The BACON domain is found in diverse domain architectures and accociated with a wide variety of domains, including carbohydrate-active enzymes and proteases. It was named for its suggested function of carbohydrate binding; the latter was inferred from domain architectures, sequence conservation, and phyletic distribution. However, recent experimental data suggest that its primary function in Bacteroides ovatus endo-xyloglucanase BoGH5A is to distance the catalytic module from the cell surface and confer additional mobility to the catalytic domain for attack of the polysaccharide. No evidence for a direct role in carbohydrate binding could be found in that case. The large majority of BACON domains are found in Bacteroidetes.
smart00231	FA58C	1.73e-04	156	267	35	129	Coagulation factor 5/8 C-terminal domain, discoidin domain. Cell surface-attached carbohydrate-binding domain, present in eukaryotes and assumed to have horizontally transferred to eubacterial genomes.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCO21431.1	4.01e-108	1	282	5	286
AIM35717.1	2.02e-15	33	267	233	441
QEH41611.1	4.63e-08	122	270	181	317
QIU94663.1	6.33e-08	130	259	329	445
CRK61066.1	6.33e-08	129	259	499	614

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000000	1.000087	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002622_01309.