CAZyme Information: MGYG000002622_01423

Basic Information

• Species: Phocaeicola sp900546095
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Phocaeicola; Phocaeicola sp900546095
• CAZyme ID: MGYG000002622_01423
• CAZy Family: GH109
• CAZyme Description: Alpha-N-acetylgalactosaminidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
379	MGYG000002622_11|CGC1	42566.99	7.12

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002622	3429958	MAG	China	Asia

• Gene Location: Start: 58522; End: 59661 Strand: +

Full Sequence      

MAAIRTSIIGLGYRGKRLLTLLSSIDDFNIVSVSDPCIDEETRRKCPSFSNGKDDYKNMI
LQCAPELVIIASPWEHHVEQALFAVLNGCHVALEIKGGLYIDEYKSLLSAAFEKKRTVYP
LENTIFMREHMSMLNLINAGLLGKIVAVKGGYRHDLRKILISEKGEIGKGSNAEGVWRSK
FYQKENGDIYPTHGLAPICLFSGIGRTDRIVELASFASSSHGIAEYISCHGGSEHPAITM
GDIIITQMLTEKGTLVTLTHDTTLPRPRSLDIEVQGSKGIWRGEFRKIYIENVSPYETWE
DDGRYIDEFEHVSWKKWGKEAIKIDEHHRGMDYIMLKMLAEDMKGTGVYPVNLNDLASWT
SVTPLSKSSIKEKRIIKLG

Enzyme Prediction     

No EC number prediction in MGYG000002622_01423.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH109	2	373	1.1e-102	0.9473684210526315

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0673	MviM	4.35e-13	1	378	1	340	Predicted dehydrogenase [General function prediction only].
pfam01408	GFO_IDH_MocA	6.79e-08	4	118	1	116	Oxidoreductase family, NAD-binding Rossmann fold. This family of enzymes utilize NADP or NAD. This family is called the GFO/IDH/MOCA family in swiss-prot.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRO24037.1	4.45e-164	1	378	1	378
ADV42950.1	3.33e-153	4	378	10	384
QUT33801.1	1.09e-152	1	378	1	378
QQA30653.1	1.09e-152	1	378	1	378
QUT62197.1	1.09e-152	1	378	1	378

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2IXA_A	3.76e-76	4	377	21	421	A-zyme,N-acetylgalactosaminidase [Elizabethkingia meningoseptica],2IXB_A Crystal structure of N-ACETYLGALACTOSAMINIDASE in complex with GalNAC [Elizabethkingia meningoseptica]
6T2B_A	5.02e-44	1	372	40	423	Glycosidehydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_B Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_C Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_D Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A4Q8F7	2.06e-75	4	377	21	421	Alpha-N-acetylgalactosaminidase OS=Elizabethkingia meningoseptica OX=238 GN=nagA PE=1 SV=1
B2FLK4	1.99e-67	4	370	34	424	Glycosyl hydrolase family 109 protein OS=Stenotrophomonas maltophilia (strain K279a) OX=522373 GN=Smlt4431 PE=3 SV=1
A4FN60	3.83e-60	4	371	61	430	Glycosyl hydrolase family 109 protein OS=Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338) OX=405948 GN=SACE_6314 PE=3 SV=1
A6LB54	8.06e-56	49	370	105	440	Glycosyl hydrolase family 109 protein OS=Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / CIP 104284 / JCM 5825 / NCTC 11152) OX=435591 GN=BDI_1155 PE=3 SV=1
A4Q8G1	6.34e-55	4	370	53	442	Alpha-N-acetylgalactosaminidase OS=Tannerella forsythia OX=28112 GN=nagA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000058	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002622_01423.