CAZyme Information: MGYG000002622_01461

Basic Information

• Species: Phocaeicola sp900546095
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Phocaeicola; Phocaeicola sp900546095
• CAZyme ID: MGYG000002622_01461
• CAZy Family: PL8
• CAZyme Description: Chondroitinase-AC

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
741	MGYG000002622_12|CGC1	81887.31	4.3718

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002622	3429958	MAG	China	Asia

• Gene Location: Start: 16128; End: 18353 Strand: +

Full Sequence      

MMRLRYLCILCGSAFLLGGLSQMLVSCSDEDPITQETPLPDEGEEPETPDPAFVEMCQKM
MGRVKDENLPSTPTGADANAQKWMGQITENGSFSDIDYSSTAYTPEWVPLQHVSRLKPMV
QAYVTEGSSLYGNEDLYNAIVNGLTYWNAVRPASDNWYHNQISVPQDVCVLLILMRYGAT
ALPEDLESDLLEWFVEDGGNPSEQTGANKSDVALHWFYRGCLQSDKETVDYAVFHTFRPL
DQVNPGEEGVQYDYSYFQHGAQLYIGGYAPVMLSGVTRLATYTVGTDYRPTANQLRTLHS
FVCDTYLPSIRGHVQFFNVVGRSVSRANALNCTTFTRTLEKLKQIDPEHAADYEQGIALL
NGSADYTSQSGRLVYHYIGDYLAYQGPDYSVGLRLSSNRTSRCENGNLENLKGYFMSDGS
LSLGVEGDEYYNIFPVWNWTRVPGVTCPQVSEIPLAAEWGVRGEADFCGGLSDGKTGLAG
FRSIYRNDGLDMSARKGYFFLDGRIVCLGSDIQAAMSDPINTAVEQCLAEGDAVYSVGGA
ETMVASDVTDQPVDYIWHRNVGYFFPVEQKVNITKGSRSGSWFDINESQSKNAVSEDVCT
IWINHENPTAEAPATYAYILVPGIGKSAMQTYNCNVDIISNTADVQAVSDSRDGTVEAIF
YKKGEISLDGLLITVDNPCALMVKKSGETAFDVSVSDPARNLSTLTVTVEKNRKSQSYTF
TSLNEERAYRGRTHTAQIVLD

Enzyme Prediction     

No EC number prediction in MGYG000002622_01461.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL8	376	624	2.6e-78	0.9839357429718876

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd01083	GAG_Lyase	3.32e-150	59	698	4	693	Glycosaminoglycan (GAG) polysaccharide lyase family. This family consists of a group of secreted bacterial lyase enzymes capable of acting on glycosaminoglycans, such as hyaluronan and chondroitin, in the extracellular matrix of host tissues, contributing to the invasive capacity of the pathogen. These are broad-specificity glycosaminoglycan lyases which recognize uronyl residues in polysaccharides and cleave their glycosidic bonds via a beta-elimination reaction to form a double bond between C-4 and C-5 of the non-reducing terminal uronyl residues of released products. Substrates include chondroitin, chondroitin 4-sulfate, chondroitin 6-sulfate, and hyaluronic acid. Family members include chondroitin AC lyase, chondroitin abc lyase, xanthan lyase, and hyalurate lyase.
pfam02278	Lyase_8	4.56e-89	375	624	3	251	Polysaccharide lyase family 8, super-sandwich domain. This family consists of a group of secreted bacterial lyase enzymes EC:4.2.2.1 capable of acting on hyaluronan and chondroitin in the extracellular matrix of host tissues, contributing to the invasive capacity of the pathogen.
pfam08124	Lyase_8_N	1.13e-60	65	331	14	291	Polysaccharide lyase family 8, N terminal alpha-helical domain. This family consists of a group of secreted bacterial lyase enzymes EC:4.2.2.1 capable of acting on hyaluronan and chondroitin in the extracellular matrix of host tissues, contributing to the invasive capacity of the pathogen.
pfam02884	Lyase_8_C	2.38e-19	639	706	1	67	Polysaccharide lyase family 8, C-terminal beta-sandwich domain. This family consists of a group of secreted bacterial lyase enzymes EC:4.2.2.1 capable of acting on hyaluronan and chondroitin in the extracellular matrix of host tissues, contributing to the invasive capacity of the pathogen.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ALJ58172.1	1.02e-155	52	740	9	712
QUT90810.1	2.85e-155	67	740	24	712
QDO70900.1	3.97e-153	90	740	64	715
QQA10589.1	1.35e-151	91	707	65	682
BCA52294.1	2.02e-151	91	707	67	684

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1CB8_A	1.12e-135	77	684	25	626	CHONDROITINASEAC LYASE FROM FLAVOBACTERIUM HEPARINUM [Pedobacter heparinus]
1HM2_A	2.11e-135	77	684	47	648	ACTIVESITE OF CHONDROITINASE AC LYASE REVEALED BY THE STRUCTURE OF ENZYME-OLIGOSACCHARIDE COMPLEXES AND MUTAGENESIS [Pedobacter heparinus],1HM3_A Active Site Of Chondroitinase Ac Lyase Revealed By The Structure Of Enzyme-Oligosaccharide Complexes And Mutagenesis [Pedobacter heparinus],1HMU_A ACTIVE SITE OF CHONDROITINASE AC LYASE REVEALED BY THE STRUCTURE OF ENZYME-OLIGOSACCHARIDE COMPLEXES AND MUTAGENESIS [Pedobacter heparinus],1HMW_A Active Site Of Chondroitinase Ac Lyase Revealed By The Structure Of Enzyme-oligosaccharide Complexes And Mutagenesis [Pedobacter heparinus]
2E24_A	1.59e-40	73	718	23	716	ChainA, Xanthan lyase [Bacillus sp. GL1]
2E22_A	2.86e-40	73	718	23	716	Crystalstructure of xanthan lyase in complex with mannose [Bacillus sp. GL1]
1J0M_A	6.88e-40	73	718	23	716	CrystalStructure of Bacillus sp. GL1 Xanthan Lyase that Acts on Side Chains of Xanthan [Bacillus sp. GL1],1J0N_A Crystal Structure of Bacillus sp. GL1 Xanthan Lyase that Acts on Side Chains of Xanthan [Bacillus sp. GL1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q59288	1.16e-134	77	684	47	648	Chondroitinase-AC OS=Pedobacter heparinus (strain ATCC 13125 / DSM 2366 / CIP 104194 / JCM 7457 / NBRC 12017 / NCIMB 9290 / NRRL B-14731 / HIM 762-3) OX=485917 GN=cslA PE=1 SV=1
Q9AQS0	3.02e-39	73	718	48	741	Xanthan lyase OS=Bacillus sp. (strain GL1) OX=84635 GN=xly PE=1 SV=1
Q54873	1.22e-27	115	661	361	957	Hyaluronate lyase OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=SP_0314 PE=1 SV=2
Q53591	1.83e-26	115	665	322	942	Hyaluronate lyase OS=Streptococcus agalactiae serotype III (strain NEM316) OX=211110 GN=hylB PE=1 SV=2
Q59801	2.71e-23	156	698	182	768	Hyaluronate lyase OS=Staphylococcus aureus (strain NCTC 8325 / PS 47) OX=93061 GN=hysA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000243	0.013793	0.985931	0.000014	0.000020	0.000012

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002622_01461.