CAZyme Information: MGYG000002622_01622

Basic Information

• Species: Phocaeicola sp900546095
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Phocaeicola; Phocaeicola sp900546095
• CAZyme ID: MGYG000002622_01622
• CAZy Family: PL8
• CAZyme Description: Chondroitinase-AC

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
673	MGYG000002622_14|CGC1	76857.02	6.445

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002622	3429958	MAG	China	Asia

• Gene Location: Start: 37560; End: 39581 Strand: +

Full Sequence      

MKKRIALLSLCFVCGLTYAQESFTDSVRLVKENYINVFIGNDPAKKALVDRLAEVPKEKE
ASDQNVIELQQLYPISREEVNRLIESIRDDGSWGDIDYADTKRSGWSPKIHTERILTMTK
YYWRERKSLDADDMSRLTGAIRRAMNFWFSSKLVCKNWWYNQIGIPRTLGPAFLLFEQEM
TGEEKREAVEVMKHSSFGMTGQNKIWLAGNVLLRALLENDWKLVREARTVIGSEITVGAG
EGIQADWSFHQHGPQQQFGNYGLSFISNMGFYSEVFAGTSLAFTGSQQKTLVSLLLDGYR
WIVWKGYWDVNALNRQLFRNADRDKGFILLFTACSLMKGSTPEVEAEIEDMIRQSGLDSD
VANTFVGNKHFWKSDYTVHRTPRWMASVRMASERVIGTELVNEDNLKGYYMADGALYTYV
RGDEYHNIFPFWNWRRIPGITTYESEAPIPDPNRTDSRNHSSRVGGVSNGTTGITAMQLR
RNGLNANKAWIFADDYILCMGSDIRSDSSASVITSVDQRFRRGEVRSCGNGRFFHDNTGY
IILQADSCAVLTEQKRGQWHDFMGMYRPEMLEEESVFSICLTHDKKRPSGYIYLILPASS
VKEVGDFDAESIRIVRNDRDVQSVVIGGLCYLAAYQKTEVKTDSGDVLDIPYPGTYIIDM
QKGEIRQKAYFEM

Enzyme Prediction     

No EC number prediction in MGYG000002622_01622.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL8	369	600	3.3e-60	0.9845559845559846

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd01083	GAG_Lyase	1.08e-129	90	666	35	687	Glycosaminoglycan (GAG) polysaccharide lyase family. This family consists of a group of secreted bacterial lyase enzymes capable of acting on glycosaminoglycans, such as hyaluronan and chondroitin, in the extracellular matrix of host tissues, contributing to the invasive capacity of the pathogen. These are broad-specificity glycosaminoglycan lyases which recognize uronyl residues in polysaccharides and cleave their glycosidic bonds via a beta-elimination reaction to form a double bond between C-4 and C-5 of the non-reducing terminal uronyl residues of released products. Substrates include chondroitin, chondroitin 4-sulfate, chondroitin 6-sulfate, and hyaluronic acid. Family members include chondroitin AC lyase, chondroitin abc lyase, xanthan lyase, and hyalurate lyase.
pfam02278	Lyase_8	3.78e-84	368	600	1	252	Polysaccharide lyase family 8, super-sandwich domain. This family consists of a group of secreted bacterial lyase enzymes EC:4.2.2.1 capable of acting on hyaluronan and chondroitin in the extracellular matrix of host tissues, contributing to the invasive capacity of the pathogen.
pfam08124	Lyase_8_N	2.96e-26	59	347	8	315	Polysaccharide lyase family 8, N terminal alpha-helical domain. This family consists of a group of secreted bacterial lyase enzymes EC:4.2.2.1 capable of acting on hyaluronan and chondroitin in the extracellular matrix of host tissues, contributing to the invasive capacity of the pathogen.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIU96737.1	0.0	1	663	1	661
QRP58609.1	0.0	13	673	14	677
ASM67245.1	0.0	13	673	14	677
QQT79509.1	0.0	13	673	14	677
QUU09892.1	0.0	13	673	14	677

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1CB8_A	1.35e-62	84	624	32	590	CHONDROITINASEAC LYASE FROM FLAVOBACTERIUM HEPARINUM [Pedobacter heparinus]
1HM2_A	1.93e-62	84	624	54	612	ACTIVESITE OF CHONDROITINASE AC LYASE REVEALED BY THE STRUCTURE OF ENZYME-OLIGOSACCHARIDE COMPLEXES AND MUTAGENESIS [Pedobacter heparinus],1HM3_A Active Site Of Chondroitinase Ac Lyase Revealed By The Structure Of Enzyme-Oligosaccharide Complexes And Mutagenesis [Pedobacter heparinus],1HMU_A ACTIVE SITE OF CHONDROITINASE AC LYASE REVEALED BY THE STRUCTURE OF ENZYME-OLIGOSACCHARIDE COMPLEXES AND MUTAGENESIS [Pedobacter heparinus],1HMW_A Active Site Of Chondroitinase Ac Lyase Revealed By The Structure Of Enzyme-oligosaccharide Complexes And Mutagenesis [Pedobacter heparinus]
1RWA_A	3.40e-30	157	624	124	658	Crystalstructure of Arthrobacter aurescens chondroitin AC lyase [Paenarthrobacter aurescens],1RWC_A Crystal structure of Arthrobacter aurescens chondroitin AC lyase [Paenarthrobacter aurescens],1RWF_A Crystal structure of Arthrobacter aurescens chondroitin AC lyase in complex with chondroitin tetrasaccharide [Paenarthrobacter aurescens],1RWG_A Crystal structure of Arthrobacter aurescens chondroitin AC lyase in complex with chondroitin tetrasaccharide [Paenarthrobacter aurescens],1RWH_A Crystal structure of Arthrobacter aurescens chondroitin AC lyase in complex with chondroitin tetrasaccharide [Paenarthrobacter aurescens]
1RW9_A	3.40e-30	157	624	124	658	Crystalstructure of the Arthrobacter aurescens chondroitin AC lyase [Paenarthrobacter aurescens]
2WCO_A	2.67e-24	114	634	93	676	Structuresof the Streptomyces coelicolor A3(2) Hyaluronan Lyase in Complex with Oligosaccharide Substrates and an Inhibitor [Streptomyces coelicolor A3(2)],2WDA_A The X-ray structure of the Streptomyces coelicolor A3 Chondroitin AC Lyase in Complex with Chondroitin sulphate [Streptomyces violaceoruber]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q59288	1.06e-61	84	624	54	612	Chondroitinase-AC OS=Pedobacter heparinus (strain ATCC 13125 / DSM 2366 / CIP 104194 / JCM 7457 / NBRC 12017 / NCIMB 9290 / NRRL B-14731 / HIM 762-3) OX=485917 GN=cslA PE=1 SV=1
Q9AQS0	1.45e-20	157	624	146	674	Xanthan lyase OS=Bacillus sp. (strain GL1) OX=84635 GN=xly PE=1 SV=1
Q59801	1.62e-13	157	647	182	745	Hyaluronate lyase OS=Staphylococcus aureus (strain NCTC 8325 / PS 47) OX=93061 GN=hysA PE=3 SV=1
Q54873	1.68e-12	150	624	400	944	Hyaluronate lyase OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=SP_0314 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000750	0.996514	0.002087	0.000206	0.000204	0.000194

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002622_01622.