CAZyme Information: MGYG000002625_01169

Basic Information

• Species: Negativibacillus massiliensis
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; Negativibacillus; Negativibacillus massiliensis
• CAZyme ID: MGYG000002625_01169
• CAZy Family: GH63
• CAZyme Description: Glucosidase YgjK

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
750	MGYG000002625_27|CGC1	85569.51	5.061

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002625	2526414	MAG	China	Asia

• Gene Location: Start: 19255; End: 21507 Strand: -

Full Sequence      

MQENKVTKQKIGKLAESYPNVLNLTADPKQVLYGTYNTNEYNHFSDLGAWHGYYLPKQGE
DRLLGGFAGPVIIAEEYPVNLSRAISRIKIMDETGKEYQLKDARQKGVSYPGRLVQHYDM
DEIALTLELVFATNRTALICATIENKTQQQKQIHLCWEGTIYQKFGTSDEEPNRFEMGTR
LSSTPNGVKVTFETIRNRWNYLTSHENCFVIAHDIQVVTTVNEQGNAFQTRTKNPVFLPA
QESFQTFETHSFTFTAEEAKTEQKKAARIIQNGENVFLASANRWENYLQKTFSGHEAEIS
YRRAAVKAIETLMTNWQSAAGAIRHDGVVPSTSYQYFIGMWAWDSWKQAVGVCAFHPQLA
KDNIRALFDYQIGQEDALRPYDKGTIIDCVFYNQNQERGGDGGNWNERNSKPPLAAWAVW
NVYRQSGDVSFVEEMYPKLVAYHEWWYQNRDADKNGIAEYGAMVDQANWKANENNDQVFD
PDAVIEAAAWESGMDNAPRFDKNGMGEDDPGVQVFENKDSGGQVIGYSINQESVDLNAYL
YAEKGFLKSMAELLGKTEDVCRWEREAKFVRDYINTYMFDEQTGYYYDLQISLGGSGKRL
LVKRGKGPEGWIPLWAKLAPKEKAERVIANMLDPNKFNTFVPLGTVSRDSESFAPDKYWR
GPVWLDQAMYGIEALQNYSYQKEARELAYKIFDHAQGLLGDEPIRENYHPLNGKGLHTTN
FSWSASSLYSLYRNVMTGEETTSQTALDLE

Enzyme Prediction     

No EC number prediction in MGYG000002625_01169.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH63	9	736	5.4e-199	0.9491228070175438

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK10137	PRK10137	0.0	14	737	28	785	alpha-glucosidase; Provisional
pfam01204	Trehalase	4.60e-17	410	731	178	505	Trehalase. Trehalase (EC:3.2.1.28) is known to recycle trehalose to glucose. Trehalose is a physiological hallmark of heat-shock response in yeast and protects of proteins and membranes against a variety of stresses. This family is found in conjunction with pfam07492 in fungi.
COG3408	GDB1	4.06e-15	159	695	148	569	Glycogen debranching enzyme (alpha-1,6-glucosidase) [Carbohydrate transport and metabolism].
PLN02567	PLN02567	3.44e-10	410	629	203	432	alpha,alpha-trehalase
pfam03200	Glyco_hydro_63	8.76e-10	534	725	252	486	Glycosyl hydrolase family 63 C-terminal domain. This is a family of eukaryotic enzymes belonging to glycosyl hydrolase family 63. They catalyze the specific cleavage of the non-reducing terminal glucose residue from Glc(3)Man(9)GlcNAc(2). Mannosyl oligosaccharide glucosidase EC:3.2.1.106 is the first enzyme in the N-linked oligosaccharide processing pathway. This family represents the C-terminal catalytic domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AYE34792.1	1.79e-307	18	749	31	749
AIY84390.1	3.23e-307	4	747	28	777
QAS60187.1	5.09e-307	18	749	31	749
API92116.1	6.42e-307	12	750	36	783
QTY16309.1	6.42e-307	12	750	36	783

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3W7S_A	2.09e-175	15	734	2	755	Escherichiacoli K12 YgjK complexed with glucose [Escherichia coli K-12],3W7S_B Escherichia coli K12 YgjK complexed with glucose [Escherichia coli K-12],3W7T_A Escherichia coli K12 YgjK complexed with mannose [Escherichia coli K-12],3W7T_B Escherichia coli K12 YgjK complexed with mannose [Escherichia coli K-12],3W7U_A Escherichia coli K12 YgjK complexed with galactose [Escherichia coli K-12],3W7U_B Escherichia coli K12 YgjK complexed with galactose [Escherichia coli K-12]
3W7X_A	1.17e-174	15	734	2	755	Crystalstructure of E. coli YgjK D324N complexed with melibiose [Escherichia coli K-12],3W7X_B Crystal structure of E. coli YgjK D324N complexed with melibiose [Escherichia coli K-12],5CA3_A Crystal structure of the glycosynthase mutant D324N of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12],5CA3_B Crystal structure of the glycosynthase mutant D324N of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12]
3W7W_A	1.66e-174	15	734	2	755	Crystalstructure of E. coli YgjK E727A complexed with 2-O-alpha-D-glucopyranosyl-alpha-D-galactopyranose [Escherichia coli K-12],3W7W_B Crystal structure of E. coli YgjK E727A complexed with 2-O-alpha-D-glucopyranosyl-alpha-D-galactopyranose [Escherichia coli K-12],5GW7_A Crystal structure of the glycosynthase mutant E727A of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12],5GW7_B Crystal structure of the glycosynthase mutant E727A of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12]
3D3I_A	4.19e-169	15	734	3	756	Crystalstructural of Escherichia coli K12 YgjK, a glucosidase belonging to glycoside hydrolase family 63 [Escherichia coli K-12],3D3I_B Crystal structural of Escherichia coli K12 YgjK, a glucosidase belonging to glycoside hydrolase family 63 [Escherichia coli K-12]
7Q6Z_B	1.34e-96	15	493	350	819	ChainB, Megabody 177 [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P42592	2.31e-174	15	734	25	778	Glucosidase YgjK OS=Escherichia coli (strain K12) OX=83333 GN=ygjK PE=1 SV=1
D8T3S4	4.91e-14	264	726	26	479	Mannosylglycerate hydrolase MGH2 OS=Selaginella moellendorffii OX=88036 GN=SELMODRAFT_447962 PE=3 SV=1
D8QTR2	1.14e-13	264	726	26	479	Mannosylglycerate hydrolase MGH1 OS=Selaginella moellendorffii OX=88036 GN=MGH PE=1 SV=1
P94250	3.22e-08	406	686	108	326	Uncharacterized protein BB_0381 OS=Borreliella burgdorferi (strain ATCC 35210 / DSM 4680 / CIP 102532 / B31) OX=224326 GN=BB_0381 PE=4 SV=2
Q757L1	9.97e-08	533	727	479	698	Probable trehalase OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) OX=284811 GN=NTH2 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000051	0.000003	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002625_01169.