CAZyme Information: MGYG000002627_00235

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Butyricicoccaceae; AM07-15
• CAZyme ID: MGYG000002627_00235
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
358		41666.02	5.9422

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002627	2286370	MAG	China	Asia

• Gene Location: Start: 54931; End: 56007 Strand: +

Full Sequence      

MKIYVYAICKDEKAFADRWMDSMSEADGVYVLDTGSQDGTPAALASRGAWVACREVVPWR
FDKARNLSLDLVPQDADLCVCTDLDEVFEKGWRKKLEQAALTQSCPQYRCRFVWSHGEDG
REGMVFWQNKIHCRHGFVWHYPVHEVLQWRGEKEYALGDAAGVCLHHWPDSHKSRGQYLP
LLELAAREEPEDPRCAHYLGREYMYQGDWNKAEEELLRHLALPHSTWEAERAASMRYLAR
CCLETGRRKEALRWFYRAVAEAPSLREGYVECAWYFSQEENWPGVLLMSQSALAITQRDK
TYINEDFAWGSVPWDLSALAFWHLGQKEKACFYGARALEKEPENQRLQQNLAFYQGEK

Enzyme Prediction     

No EC number prediction in MGYG000002627_00235.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd02511	Beta4Glucosyltransferase	5.19e-07	2	167	1	164	UDP-glucose LOS-beta-1,4 glucosyltransferase is required for biosynthesis of lipooligosaccharide. UDP-glucose: lipooligosaccharide (LOS) beta-1-4-glucosyltransferase catalyzes the addition of the first residue, glucose, of the lacto-N-neotetrase structure to HepI of the LOS inner core. LOS is the major constituent of the outer leaflet of the outer membrane of gram-positive bacteria. It consists of a short oligosaccharide chain of variable composition (alpha chain) attached to a branched inner core which is lined in turn to lipid A. Beta 1,4 glucosyltransferase is required to attach the alpha chain to the inner core.
sd00006	TPR	2.86e-06	172	260	11	97	Tetratricopeptide repeat. The Tetratricopeptide repeat (TPR) typically contains 34 amino acids and is found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans. It is present in a variety of proteins including those involved in chaperone, cell-cycle, transcription, and protein transport complexes. The number of TPR motifs varies among proteins. Those containing 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accommodate an alpha-helix of a target protein. It has been proposed that TPR proteins preferentially interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes.
sd00006	TPR	1.66e-05	193	282	1	85	Tetratricopeptide repeat. The Tetratricopeptide repeat (TPR) typically contains 34 amino acids and is found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans. It is present in a variety of proteins including those involved in chaperone, cell-cycle, transcription, and protein transport complexes. The number of TPR motifs varies among proteins. Those containing 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accommodate an alpha-helix of a target protein. It has been proposed that TPR proteins preferentially interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes.
pfam13432	TPR_16	7.32e-05	199	264	3	66	Tetratricopeptide repeat. This family is found predominantly at the C-terminus of transglutaminase enzyme core regions.
pfam13424	TPR_12	2.29e-04	196	260	6	73	Tetratricopeptide repeat.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ANU42689.1	1.03e-127	1	356	1	356
QQR04409.1	1.03e-127	1	356	1	356
QIA29496.1	2.07e-127	1	356	1	356
AQS58818.1	4.11e-127	1	353	4	355
AQS58819.1	7.64e-118	1	353	4	355

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000052	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002627_00235.