CAZyme Information: MGYG000002633_00118

Basic Information

• Species: TF01-11 sp003149875
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; TF01-11; TF01-11 sp003149875
• CAZyme ID: MGYG000002633_00118
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
612	MGYG000002633_1|CGC1	71846.68	7.0898

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002633	2903436	MAG	China	Asia

• Gene Location: Start: 147137; End: 148975 Strand: +

Full Sequence      

MILQEMVYPDKEICTVEQMYLRTQQGKVTFDDGAFHLMQDTIASTLTYFNAFSIGKWNTY
TDVEQISLHLFLKGQGQIELCIFDGSETIVLERRDFIHTEITEESFTLLMQEETKLSFVN
KKESVLCFARIIAKEECLLTNIQYQTTKKPIRQIELAIGICTYRREEYVQRTLKMLADQI
LCDVHSPLYHHVKVYVSDNGNTLDTTQTYSDAVKVFYNKNAGGTGGFTRCMIETMEDKTE
FTHILLMDDDIKIHADTIKRTWLLLAYANEKYKDSVVGGALLRTDHPNIQHTNAEIWDID
RVQTMHQGLDMCNVTQLSQNEEILRSDYNGWWYCCIPVATIKEVQLPLPFFIHMDDIEYG
IRLDCPIMTMNGIGVWHDSFEHRKASSVEYYDMRNLLTANAIHNSKYTKKQAKKRVMRHL
VFQLLKYRYEDWKLTIKGVEDFCKGTDFYKTTDPVKLHQQIMQMGYQMTDQSQTLQNCDC
LEDIKKKEQKGTVSDRAGEEEPVSLYQVKAHSKMDFLTLNGWLLPGKRKLVPLPMGCCSK
DLFRVRKVVYYDPESKKGFVTQRKWRKLFELLWQCHKVNRLLDQNFDKAVKDYQKNYKEI
TNMAFWKRYLEL

Enzyme Prediction     

No EC number prediction in MGYG000002633_00118.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	156	364	1.2e-16	0.8304347826086956

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1216	GT2	1.67e-23	154	445	3	286	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].
cd04185	GT_2_like_b	6.25e-11	160	397	3	200	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
pfam13641	Glyco_tranf_2_3	7.08e-10	156	364	4	195	Glycosyltransferase like family 2. Members of this family of prokaryotic proteins include putative glucosyltransferase, which are involved in bacterial capsule biosynthesis.
cd04186	GT_2_like_c	1.53e-04	158	279	1	110	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
cd00761	Glyco_tranf_GTA_type	1.97e-04	158	282	1	117	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUI96744.1	1.60e-118	9	612	29	616
QUI96741.1	1.11e-115	1	610	1	574
QOX65077.1	1.93e-101	3	612	4	612
QNP28936.1	4.40e-97	3	612	23	628
BAZ80590.1	2.59e-93	3	612	26	629

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4FIX_A	6.89e-29	44	447	75	490	CrystalStructure of GlfT2 [Mycobacterium tuberculosis H37Rv],4FIX_B Crystal Structure of GlfT2 [Mycobacterium tuberculosis H37Rv],4FIY_A Crystal Structure of GlfT2 Complexed with UDP [Mycobacterium tuberculosis H37Rv],4FIY_B Crystal Structure of GlfT2 Complexed with UDP [Mycobacterium tuberculosis H37Rv]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O53585	3.47e-28	44	447	55	470	Galactofuranosyltransferase GlfT2 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=glfT2 PE=1 SV=1
A0R628	1.12e-24	44	447	66	479	Galactofuranosyltransferase GlfT2 OS=Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) OX=246196 GN=glfT2 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000053	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002633_00118.