CAZyme Information: MGYG000002636_00757

Basic Information

• Species: Prevotella veroralis
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella veroralis
• CAZyme ID: MGYG000002636_00757
• CAZy Family: GH26
• CAZyme Description: Mannan endo-1,4-beta-mannosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
383	MGYG000002636_18|CGC1	44502.78	9.3715

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002636	2075441	MAG	China	Asia

• Gene Location: Start: 30897; End: 32048 Strand: +

Full Sequence      

MKIYKKQPLQFSEMRKVILIIAIALLTINAVARKNMQKSPADQLIERLQQLRKYGIMFGH
QDALFYGTTWKWEYGRSDVNDVCGDYPAVLGCELGGLELGNEKNLDGVPFDKMRQQIIEH
YKKGGIITISWHPYNPVTGQNAWNTEGNAVTAVLPGGKENVKLKLWHKRLVSFFKSLKDN
KGNSIPVIFRPWHEMSGSWFWWGYQQCTPEQYKTLYQLTYNTMRQAGLSNIVWSYSPNAQ
ADDTAEHYFRFYPGDKYVDVLGVDLYQNNGRQDFINQCQNEMQIMSAYAKSHNKLYALTE
AGYRNTPDEKWYTSTLLPGIKGFKPCYVLLWRNAWDNAEENFGPAPEKACAKDFKDIYKQ
GAFLFRSHLEKYTEKRKCNRHKN

Enzyme Prediction     

No EC number prediction in MGYG000002636_00757.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH26	39	311	4.8e-64	0.8382838283828383

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam02156	Glyco_hydro_26	1.80e-39	41	269	9	233	Glycosyl hydrolase family 26.
COG4124	ManB2	2.22e-17	129	270	117	260	Beta-mannanase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUB41950.1	1.65e-275	14	376	1	363
QUB69107.1	2.63e-272	14	376	1	363
QUB47762.1	1.44e-217	11	375	2	366
VEH15499.1	1.16e-216	22	375	2	355
QUI92957.1	2.40e-208	13	367	2	356

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4ZXO_A	8.81e-100	37	365	7	335	Thestructure of a GH26 beta-mannanase from Bacteroides ovatus, BoMan26A. [Bacteroides ovatus]
2VX5_A	4.99e-75	44	369	45	391	CellvibrioJaponicus Mannanase Cjman26c Mannose-Bound Form [Cellvibrio japonicus]
2VX4_A	4.99e-75	44	369	45	391	CellvibrioJaponicus Mannanase Cjman26c Native Form [Cellvibrio japonicus],2VX6_A CELLVIBRIO JAPONICUS MANNANASE CJMAN26C Gal1Man4-BOUND FORM [Cellvibrio japonicus]
4CD4_A	9.43e-75	44	369	68	414	Thestructure of GH26 beta-mannanase CjMan26C from Cellvibrio japonicus in complex with ManIFG [Cellvibrio japonicus Ueda107],4CD5_A The structure of GH26 beta-mannanase CjMan26C from Cellvibrio japonicus in complex with ManMIm [Cellvibrio japonicus Ueda107]
2VX7_A	3.92e-74	44	369	45	391	CellvibrioJaponicus Mannanase Cjman26c Mannobiose-Bound Form [Cellvibrio japonicus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P49424	8.53e-43	48	334	65	363	Mannan endo-1,4-beta-mannosidase OS=Cellvibrio japonicus (strain Ueda107) OX=498211 GN=manA PE=1 SV=2
A1A278	4.05e-35	44	302	54	318	Mannan endo-1,4-beta-mannosidase OS=Bifidobacterium adolescentis (strain ATCC 15703 / DSM 20083 / NCTC 11814 / E194a) OX=367928 GN=BAD_1030 PE=1 SV=1
O05512	1.85e-24	79	338	79	331	Mannan endo-1,4-beta-mannosidase OS=Bacillus subtilis (strain 168) OX=224308 GN=gmuG PE=1 SV=2
P55278	2.47e-24	55	266	59	266	Mannan endo-1,4-beta-mannosidase OS=Bacillus subtilis OX=1423 PE=3 SV=1
Q5AWB7	2.07e-18	67	308	51	302	Probable mannan endo-1,4-beta-mannosidase E OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=manE PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.003469	0.995473	0.000507	0.000168	0.000172	0.000168

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002636_00757.