CAZyme Information: MGYG000002636_01117

Basic Information

• Species: Prevotella veroralis
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella veroralis
• CAZyme ID: MGYG000002636_01117
• CAZy Family: CBM50
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
471	MGYG000002636_32|CGC1	53678.43	9.5197

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002636	2075441	MAG	China	Asia

• Gene Location: Start: 2823; End: 4238 Strand: -

Full Sequence      

MCIKNSLRYLLLLFTIMISCSVMAQNVVWRDQHQVKRKETIFGIAKEYGVTIQQLIDSNP
IMKTAGYELKKGELILVPFAKDGDIRPDGSIMGKTVKPSKADKEAKKKGANAAAIAKQEN
AIHVGIMLPLHNQDGDGKRMIEFYRGVLLALNEMKSEGITTDVHAWNVPKDADIRTTLLD
PNASKLDLIFGPLYSDQVKPLADFCRAHGTKLVIPFSITGNEVENNSNIYQVYQTEESLN
SKAIASFLERFQKSHHPVFINCNDASSQVGNFTSLLRKQLNILKIKYDLTSLKSSAADFA
KHFDKTRPNVVVLNSEKSPQLNEVFAKLAQLKKTNPGIAIALFGYNQWFVYQDYDLDNFF
RYNTYIPSTYYYNKSSERTKSLEAKYNEQYDEPMAKQYIPRLALTGYDQAQFFVRGIKAQ
GKDFKGVYSDVKYRPLQTRYNFERVGQGGYINNNFQLIHFTTDQKMENLVY

Enzyme Prediction     

No EC number prediction in MGYG000002636_01117.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd00118	LysM	1.22e-05	33	61	3	31	Lysin Motif is a small domain involved in binding peptidoglycan. LysM, a small globular domain with approximately 40 amino acids, is a widespread protein module involved in binding peptidoglycan in bacteria and chitin in eukaryotes. The domain was originally identified in enzymes that degrade bacterial cell walls, but proteins involved in many other biological functions also contain this domain. It has been reported that the LysM domain functions as a signal for specific plant-bacteria recognition in bacterial pathogenesis. Many of these enzymes are modular and are composed of catalytic units linked to one or several repeats of LysM domains. LysM domains are found in bacteria and eukaryotes.
smart00257	LysM	2.50e-05	33	77	2	44	Lysin motif.
pfam01476	LysM	4.30e-04	33	59	1	27	LysM domain. The LysM (lysin motif) domain is about 40 residues long. It is found in a variety of enzymes involved in bacterial cell wall degradation. This domain may have a general peptidoglycan binding function. The structure of this domain is known.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUB42233.1	0.0	23	471	1	449
QUB86322.1	3.86e-268	4	471	2	462
AKU69648.1	3.86e-268	4	471	2	462
QKH88916.1	1.21e-262	4	471	2	463
QUB90462.1	1.54e-262	4	471	2	460

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.001195	0.427745	0.570330	0.000275	0.000218	0.000213

TMHMM  Annotations     

start	end
7	29