CAZyme Information: MGYG000002637_01933

Basic Information

• Species: Prevotella jejuni
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella jejuni
• CAZyme ID: MGYG000002637_01933
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
399		46237.7	8.9434

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002637	2560086	MAG	China	Asia

• Gene Location: Start: 8708; End: 9907 Strand: +

Full Sequence      

MKYYLIVGEASGDLHASRLMQSLIQYDPEAEFRFFGGDLMAKVGGTRVKHYRELAYMGFI
PVLLHLPTIFKNMKMCKEDIMRWKPDAVILVDYPGFNLSIAKFVKKNTSIPVYYYISPKI
WAWKEWRIKAIKRDVKEMFSILPFEVAFYEKKHHYKIHYVGNPTAEEVDNFLHVYSESKD
EFCQRNGLSSKPIIAILAGSRKQEIKDNLPSMLEAARHFEDYQMVVAAAPSITESYYKRF
LENSEAKMVKTQTYELLAHATVALVTSGTATLETALLNVPQVVCYETPVPKLIRFAFKHI
IKVRFISLVNLIADKEIVQELLADRFSIRNIANELYRILPGQPSRERMLADYQLVRERLG
NEVAPDNAARIMVEKLTNRRVYDMSSKPENEFISEQTYE

Enzyme Prediction     

No EC number prediction in MGYG000002637_01933.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	4	359	4.2e-116	0.9887005649717514

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00025	lpxB	2.17e-104	1	380	2	379	lipid-A-disaccharide synthase; Reviewed
COG0763	LpxB	1.64e-96	1	374	2	377	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
pfam02684	LpxB	1.02e-69	4	364	2	363	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
TIGR00215	lpxB	1.50e-61	5	374	10	384	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK14089	PRK14089	3.37e-54	1	372	2	344	lipid-A-disaccharide synthase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AUI54933.1	3.61e-287	1	399	1	399
QUB78097.1	1.04e-286	1	399	1	399
QUB81085.1	2.09e-286	1	399	1	399
QUB61849.1	5.88e-277	1	399	1	399
QUB65076.1	8.36e-277	1	399	1	399

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8S_A	6.18e-26	5	374	11	379	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]
5W8N_A	1.59e-25	5	374	11	379	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q1D393	2.88e-60	5	381	9	383	Lipid-A-disaccharide synthase OS=Myxococcus xanthus (strain DK1622) OX=246197 GN=lpxB PE=3 SV=1
Q39T49	1.25e-58	5	380	11	384	Lipid-A-disaccharide synthase OS=Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15) OX=269799 GN=lpxB PE=3 SV=1
Q02AZ6	1.03e-55	2	385	3	381	Lipid-A-disaccharide synthase OS=Solibacter usitatus (strain Ellin6076) OX=234267 GN=lpxB PE=3 SV=1
Q74AT9	1.55e-55	5	376	11	380	Lipid-A-disaccharide synthase OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) OX=243231 GN=lpxB PE=3 SV=1
Q2LVL8	8.25e-55	5	369	8	371	Lipid-A-disaccharide synthase OS=Syntrophus aciditrophicus (strain SB) OX=56780 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000049	0.000012	0.000001	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002637_01933.