CAZyme Information: MGYG000002638_00328

Basic Information

• Species: Lachnoanaerobaculum orale
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Lachnoanaerobaculum; Lachnoanaerobaculum orale
• CAZyme ID: MGYG000002638_00328
• CAZy Family: GH105
• CAZyme Description: Unsaturated rhamnogalacturonyl hydrolase YteR

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
383	MGYG000002638_7|CGC1	45016.5	5.6534

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002638	2571408	MAG	China	Asia

• Gene Location: Start: 27468; End: 28619 Strand: -

Full Sequence      

MVKKEKYILLDKYIDFLLENSDASSPMWNIEQIRSGRKNKWNYIDACMISAYLELYEIKR
DKKYLNFCDDFVSAFVNEDGSINTYDIEEYNIDNIRPGKNLFKLFELTGKKKYRKAMDTV
YSQLKTMPRTDEGNFWHKKIYPYQVWLDGLYMAQPFYMEYETKYNRMRFCIDSFSQFENV
ERIMKDTNTGLYYHGYDESRQSLWCDKKTGLSKNFWLRSIGWFILSLVDTALAIDESLYY
EFRRLKEMLYNLANDLLKFQDDSGMFYQLVDRKGDKGNYLETSGSALISYAFLKAARNKL
LPKRFEDIGKKIFDGILDRYLCVEGEELSLGGICLVAGLGGKENRDGSAEYYYSEPVVKN
EAKGVAPLLMAYTEIIRLGMAYD

Enzyme Prediction     

No EC number prediction in MGYG000002638_00328.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	36	377	1.2e-104	0.9759036144578314

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4225	YesR	8.13e-91	38	378	31	356	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].
pfam07470	Glyco_hydro_88	1.47e-76	31	378	17	342	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADL35233.1	5.93e-192	1	377	1	378
ADZ83101.1	1.03e-164	9	378	3	372
QEH68585.1	1.47e-164	9	378	3	372
ATP00557.1	3.31e-163	1	376	1	378
QIA43718.1	3.31e-163	1	376	1	378

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WU0_A	5.51e-95	41	374	23	357	StructuralAnalysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824],4WU0_B Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824]
1NC5_A	6.70e-53	39	375	37	364	Structureof Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	2.84e-52	39	375	27	354	ChainA, Putative glycosyl hydrolase yteR [Bacillus subtilis]
3QWT_A	7.97e-11	91	328	108	339	ChainA, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_B Chain B, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_C Chain C, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_D Chain D, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O34559	3.67e-52	39	375	37	364	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1
P0A3U6	4.70e-39	152	378	1	231	Protein Atu3128 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) OX=176299 GN=Atu3128 PE=3 SV=1
P0A3U7	4.70e-39	152	378	1	231	24.9 kDa protein in picA locus OS=Rhizobium radiobacter OX=358 PE=2 SV=1
O31521	1.36e-18	41	316	29	290	Unsaturated rhamnogalacturonyl hydrolase YesR OS=Bacillus subtilis (strain 168) OX=224308 GN=yesR PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000077	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002638_00328.