CAZyme Information: MGYG000002638_00670

Basic Information

• Species: Lachnoanaerobaculum orale
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Lachnoanaerobaculum; Lachnoanaerobaculum orale
• CAZyme ID: MGYG000002638_00670
• CAZy Family: GH25
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
635		71717.95	6.2746

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002638	2571408	MAG	China	Asia

• Gene Location: Start: 28365; End: 30272 Strand: -

Full Sequence      

MHLNKFSKAAISISLAMTLLTPMTAFAANEWTMQSPGVYQMLDGSSLSGVVARGIDLSHY
QGNVDWDKVAADDVQFILHGTRYKGQIDPVIRKNLSEANKRGIKLGVYIYSYAMSVEQAE
AEADFVLDIIKDYPISYPVAFDVEDANTQGKLPKDQLTAIIKKFCDKVEAAGYYPIVYAN
DYWIANKLDMNALKKYDIWVARYNVKHSYPNPVMWQATSTGKVNGINGNVDIDFQYKSFS
DKIPSTTWRTIAGKRYYFKDYDMVKNAWVHDNKNSYYMGSDGVAKTGWYTENNATYYLDP
QNSGAAKKGWYNENNAWYYLDNSDGKMQTGWYADGNKRYYSDKDGKMQTGWLVDGKDTYF
LNPSGAMATGWISDGNIWYFMDKSGKMLTGWVDTGNQRYYLDNTGKMLTGWTDIGNSRYF
LAPSGAMSKGWLNESGTWYYMDNNGKMQTGWVNDRGTWYYMDNTGKMQTGWINDGRNKYF
MTDSGAMQTGWLKQDNGWYYIDGSGSMRTGWVNDGGTWYYMDDSGRMKTGWIDSGNNRYF
LSPSGAMKTGWVNDNNNWYYLSGSGAMSKGMINVNNVSYYLDENGRMLANTTVIKHGTEY
NIDASGAMTPVVTESTTAQETSTVSTQASVGPRAN

Enzyme Prediction     

No EC number prediction in MGYG000002638_00670.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH25	55	226	1.6e-44	0.9943502824858758

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06414	GH25_LytC-like	1.52e-73	53	236	2	191	The LytC lysozyme of Streptococcus pneumoniae is a bacterial cell wall hydrolase that cleaves the beta1-4-glycosydic bond located between the N-acetylmuramoyl-N-glucosaminyl residues of the cell wall polysaccharide chains. LytC is composed of a C-terminal glycosyl hydrolase family 25 (GH25) domain and an N-terminal choline-binding module (CBM) consisting of eleven homologous repeats that specifically recognizes the choline residues of pneumococcal lipoteichoic and teichoic acids. This domain arrangement is the reverse of the major pneumococcal autolysin, LytA, and the CPL-1-like lytic enzymes of the pneumococcal bacteriophages, in which the CBM (consisting of six repeats) is at the C-terminus. This model represents the C-terminal catalytic domain of the LytC-like enzymes.
NF033930	pneumo_PspA	1.31e-65	363	585	437	657	pneumococcal surface protein A. The pneumococcal surface protein proteins, found in Streptococcus pneumoniae, are repetitive, with patterns of localized high sequence identity across pairs of proteins given different specific names that recombination may be presumed. This protein, PspA, has an N-terminal region that lacks a cross-wall-targeting YSIRK type extended signal peptide, in contrast to the closely related choline-binding protein CbpA which has a similar C-terminus but a YSIRK-containing region at the N-terminus.
NF033838	PspC_subgroup_1	2.32e-58	369	585	486	680	pneumococcal surface protein PspC, choline-binding form. The pneumococcal surface protein PspC, as described in Streptococcus pneumoniae, is a repetitive and highly variable protein, recognized by a conserved N-terminal domain and also by genomic location. This form, subgroup 1, has variable numbers of a choline-binding repeat in the C-terminal region, and is also known as choline-binding protein A. The other form, subgroup 2, is anchored covalently after cleavage by sortase at a C-terminal LPXTG site.
NF033838	PspC_subgroup_1	4.37e-57	409	601	486	679	pneumococcal surface protein PspC, choline-binding form. The pneumococcal surface protein PspC, as described in Streptococcus pneumoniae, is a repetitive and highly variable protein, recognized by a conserved N-terminal domain and also by genomic location. This form, subgroup 1, has variable numbers of a choline-binding repeat in the C-terminal region, and is also known as choline-binding protein A. The other form, subgroup 2, is anchored covalently after cleavage by sortase at a C-terminal LPXTG site.
NF033930	pneumo_PspA	1.19e-56	423	608	437	621	pneumococcal surface protein A. The pneumococcal surface protein proteins, found in Streptococcus pneumoniae, are repetitive, with patterns of localized high sequence identity across pairs of proteins given different specific names that recombination may be presumed. This protein, PspA, has an N-terminal region that lacks a cross-wall-targeting YSIRK type extended signal peptide, in contrast to the closely related choline-binding protein CbpA which has a similar C-terminus but a YSIRK-containing region at the N-terminus.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AYA98687.1	8.01e-151	1	344	1	344
QUI96762.1	1.76e-83	4	271	5	276
QQR03194.1	1.02e-74	29	266	78	312
ANU47907.1	1.02e-74	29	266	78	312
QRV19588.1	9.65e-74	37	278	41	281

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000290	0.998919	0.000231	0.000199	0.000194	0.000169

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002638_00670.