CAZyme Information: MGYG000002639_00170

Basic Information

• Species: Haemophilus sp002998595
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Pasteurellaceae; Haemophilus; Haemophilus sp002998595
• CAZyme ID: MGYG000002639_00170
• CAZy Family: GT51
• CAZyme Description: Biosynthetic peptidoglycan transglycosylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
194		22231.6	10.1485

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002639	1663723	MAG	China	Asia

• Gene Location: Start: 81551; End: 82135 Strand: -

Full Sequence      

MVQQKIGHILQGDFRYKTQYDWVNLENISPSAQLAVIASEDQRFPDHFGFDFEAIQRAIK
YNEKSPKRVRGASTISQQTAKNLILWHGQNWLRKGLEVPATLLLEITWSKKRILEVYLNI
AEFGNGIFGIEAASHYYFKKAAKNLTSNEAALLAAILPNPIIYNANKPSALIRKKQAWIL
RQMRNLGTEYLNDL

Enzyme Prediction     

EC	2.4.1.129

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT51	16	184	2.2e-57	0.9491525423728814

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00056	mtgA	2.67e-121	1	193	41	233	monofunctional biosynthetic peptidoglycan transglycosylase; Provisional
TIGR02070	mono_pep_trsgly	5.67e-104	1	189	36	224	monofunctional biosynthetic peptidoglycan transglycosylase. This family is one of the transglycosylases involved in the late stages of peptidoglycan biosynthesis. Members tend to be small, about 240 amino acids in length, and consist almost entirely of a domain described by pfam00912 for transglycosylases. Species with this protein will have several other transglycosylases as well. All species with this protein are Proteobacteria that produce murein (peptidoglycan). [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
COG0744	MrcB	1.78e-77	1	187	58	244	Membrane carboxypeptidase (penicillin-binding protein) [Cell wall/membrane/envelope biogenesis].
pfam00912	Transgly	4.52e-73	21	184	14	177	Transglycosylase. The penicillin-binding proteins are bifunctional proteins consisting of transglycosylase and transpeptidase in the N- and C-terminus respectively. The transglycosylase domain catalyzes the polymerization of murein glycan chains.
COG5009	MrcA	2.01e-36	23	187	70	234	Membrane carboxypeptidase/penicillin-binding protein [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVM60722.1	1.06e-136	1	194	53	246
BBE87141.1	1.98e-120	1	194	1	194
BBE90550.1	1.98e-120	1	194	1	194
BBF06271.1	3.99e-120	1	194	1	194
VEB29251.1	3.99e-120	1	194	1	194

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2OQO_A	1.18e-27	22	187	22	187	Crystalstructure of a peptidoglycan glycosyltransferase from a class A PBP: insight into bacterial cell wall synthesis [Aquifex aeolicus VF5],3D3H_A Crystal structure of a complex of the peptidoglycan glycosyltransferase domain from Aquifex aeolicus and neryl moenomycin A [Aquifex aeolicus],3NB7_A Crystal structure of Aquifex Aeolicus Peptidoglycan Glycosyltransferase in complex with Decarboxylated Neryl Moenomycin [Aquifex aeolicus]
3NB6_A	4.62e-27	22	187	22	187	Crystalstructure of Aquifex aeolicus peptidoglycan glycosyltransferase in complex with Methylphosphoryl Neryl Moenomycin [Aquifex aeolicus]
4OON_A	5.22e-22	35	187	54	206	Crystalstructure of PBP1a in complex with compound 17 ((4Z,8S,11E,14S)-5-(2-amino-1,3-thiazol-4-yl)-14-(5,6-dihydroxy-1,3-dioxo-1,3-dihydro-2H-isoindol-2-yl)-8-formyl-2-methyl-6-oxo-3,10-dioxa-4,7,11-triazatetradeca-4,11-diene-2,12,14-tricarboxylic acid) [Pseudomonas aeruginosa PAO1]
5FGZ_A	1.52e-20	36	194	172	336	E.coli PBP1b in complex with FPI-1465 [Escherichia coli K-12],5HL9_A E. coli PBP1b in complex with acyl-ampicillin and moenomycin [Escherichia coli K-12],5HLA_A E. coli PBP1b in complex with acyl-cephalexin and moenomycin [Escherichia coli K-12],5HLB_A E. coli PBP1b in complex with acyl-aztreonam and moenomycin [Escherichia coli K-12],5HLD_A E. coli PBP1b in complex with acyl-CENTA and moenomycin [Escherichia coli K-12],6YN0_A Structure of E. coli PBP1b with a FtsN peptide activating transglycosylase activity [Escherichia coli K-12],7LQ6_A Chain A, Penicillin-binding protein 1B [Escherichia coli K-12]
3VMA_A	1.53e-20	36	194	193	357	CrystalStructure of the Full-Length Transglycosylase PBP1b from Escherichia coli [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P44890	1.11e-116	1	194	53	246	Biosynthetic peptidoglycan transglycosylase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=mtgA PE=3 SV=1
A5UDP3	2.87e-106	1	175	53	227	Biosynthetic peptidoglycan transglycosylase OS=Haemophilus influenzae (strain PittEE) OX=374930 GN=mtgA PE=3 SV=1
Q65S86	6.01e-102	1	194	52	244	Biosynthetic peptidoglycan transglycosylase OS=Mannheimia succiniciproducens (strain MBEL55E) OX=221988 GN=mtgA PE=3 SV=1
Q9CNV0	2.39e-85	1	194	53	245	Biosynthetic peptidoglycan transglycosylase OS=Pasteurella multocida (strain Pm70) OX=272843 GN=mtgA PE=3 SV=1
A8AQ99	5.33e-81	1	189	45	233	Biosynthetic peptidoglycan transglycosylase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) OX=290338 GN=mtgA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000060	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002639_00170.