CAZyme Information: MGYG000002639_00324

Basic Information

• Species: Haemophilus sp002998595
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Pasteurellaceae; Haemophilus; Haemophilus sp002998595
• CAZyme ID: MGYG000002639_00324
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
390		43612.11	7.2125

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002639	1663723	MAG	China	Asia

• Gene Location: Start: 12137; End: 13309 Strand: -

Full Sequence      

MNKTNPTIALVAGEVSGDILGAGLIRQLKAHYPNARFIGIAGPRMLAEGCETLVDMEELS
VMGLAEILKHLPRLLKIRKNVIQTMLQEKPDVYIGIDAPDFNLDVELKLKANGIKTIHYV
SPSVWAWRQNRIHKIAKATHQVLAFLPFEKAFYDKFNVPCRFIGHTMADAIPLKPNRAEA
CQMLQIDPTQRYLAILVGSRGSEVEFLAEPFLKTALLLKEQFPDLQFLVPLVNEKRRIQF
EAIKAKIAPNLDLNLIDGHARQAMIAADATLLASGTAALEAMLCKSPMVVGYRMKPLTYF
LAKRLVKTDYISLPNLLANEMLVPEMIQEECTPELLAEKLSTYLSDDESAVKNRHVLIQH
FTDLHQKIQCNADKQAAQAVIDLLEGTENV

Enzyme Prediction     

No EC number prediction in MGYG000002639_00324.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	8	369	3.1e-139	0.9943502824858758

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
TIGR00215	lpxB	0.0	1	383	1	385	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
COG0763	LpxB	0.0	6	386	2	381	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
PRK00025	lpxB	0.0	5	386	1	377	lipid-A-disaccharide synthase; Reviewed
pfam02684	LpxB	0.0	8	380	1	374	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
PRK01021	lpxB	3.51e-52	5	340	226	566	lipid-A-disaccharide synthase; Reviewed

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVM60153.1	1.44e-277	1	390	1	390
BBE95679.1	2.92e-277	1	390	1	390
SQH96359.1	2.92e-277	1	390	1	390
AIB46209.1	2.92e-277	1	390	1	390
VEB29024.1	2.92e-277	1	390	1	390

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8N_A	1.33e-163	1	385	1	382	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]
5W8S_A	2.68e-163	1	385	1	382	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A5UD44	3.37e-277	1	390	1	390	Lipid-A-disaccharide synthase OS=Haemophilus influenzae (strain PittEE) OX=374930 GN=lpxB PE=3 SV=1
Q4QLM6	6.80e-277	1	390	1	390	Lipid-A-disaccharide synthase OS=Haemophilus influenzae (strain 86-028NP) OX=281310 GN=lpxB PE=3 SV=1
P45011	7.94e-276	1	390	1	390	Lipid-A-disaccharide synthase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=lpxB PE=3 SV=2
A5UII8	4.40e-273	1	390	1	390	Lipid-A-disaccharide synthase OS=Haemophilus influenzae (strain PittGG) OX=374931 GN=lpxB PE=3 SV=1
Q9CJK7	5.60e-226	1	385	4	388	Lipid-A-disaccharide synthase OS=Pasteurella multocida (strain Pm70) OX=272843 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000040	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002639_00324.