CAZyme Information: MGYG000002640_01442

Basic Information

• Species: Veillonella sp900757715
• Lineage: Bacteria; Firmicutes_C; Negativicutes; Veillonellales; Veillonellaceae; Veillonella; Veillonella sp900757715
• CAZyme ID: MGYG000002640_01442
• CAZy Family: GH3
• CAZyme Description: Beta-hexosaminidase A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
382	MGYG000002640_21|CGC1	41732.86	5.1405

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002640	2032895	MAG	China	Asia

• Gene Location: Start: 18231; End: 19379 Strand: +

Full Sequence      

MFRRFVAATMIGALALTTGCGLHNPFTSKAEPVTYESVAQSELSPEQKVDKLVANMSDAD
KVGQLLMIGIHGTTLNDDAKFMLNEYRVGGIILFDRNMESKDQVKTLITDINKAGKSAGL
MPLFLGIDQEGGAVARMDDKLIKVPPAEEVGKMPVEQAVSLAKQSGAELKDLGFNINFAP
VADLGLTYGRSYSTSPDEVVRYAGAVGKAYDEAGLWYSYKHFPGIGKTDVDLHADTSIVP
ASKETLLSEDTKVFVDLIKQSKSNTYTIMVSHAMYPQIDPDHPASLSKAIITDWLCKDIG
YNGVVVTDDMDMGALANHYTFGDMAVQSILAGSDILLVCHEYEHMQEAYNGLMKAVKDGR
ISKERLDESVKRILLMKMNKIS

Enzyme Prediction     

No EC number prediction in MGYG000002640_01442.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	121	338	1.7e-39	0.9583333333333334

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1472	BglX	1.45e-72	56	377	1	312	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
pfam00933	Glyco_hydro_3	3.85e-66	60	374	4	314	Glycosyl hydrolase family 3 N terminal domain.
PRK05337	PRK05337	4.72e-50	66	363	4	304	beta-hexosaminidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QQB17095.1	1.09e-270	1	381	1	381
ACZ25449.1	1.09e-270	1	381	1	381
SNV02550.1	1.09e-270	1	381	1	381
CAB1277476.1	3.10e-268	1	382	1	382
BBU37286.1	8.33e-257	1	382	1	382

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6K5J_A	3.60e-62	61	380	16	340	Structureof a glycoside hydrolase family 3 beta-N-acetylglucosaminidase from Paenibacillus sp. str. FPU-7 [Paenibacillaceae]
4ZM6_A	3.94e-40	53	377	3	337	Aunique GCN5-related glucosamine N-acetyltransferase region exist in the fungal multi-domain GH3 beta-N-acetylglucosaminidase [Rhizomucor miehei CAU432],4ZM6_B A unique GCN5-related glucosamine N-acetyltransferase region exist in the fungal multi-domain GH3 beta-N-acetylglucosaminidase [Rhizomucor miehei CAU432]
7VI6_A	9.35e-39	67	341	5	279	ChainA, Beta-N-acetylhexosaminidase [Akkermansia muciniphila ATCC BAA-835],7VI6_B Chain B, Beta-N-acetylhexosaminidase [Akkermansia muciniphila ATCC BAA-835],7VI7_A Chain A, Beta-N-acetylhexosaminidase [Akkermansia muciniphila ATCC BAA-835],7VI7_B Chain B, Beta-N-acetylhexosaminidase [Akkermansia muciniphila ATCC BAA-835]
3BMX_A	8.18e-38	40	380	23	396	Beta-N-hexosaminidase(YbbD) from Bacillus subtilis [Bacillus subtilis],3BMX_B Beta-N-hexosaminidase (YbbD) from Bacillus subtilis [Bacillus subtilis],3NVD_A Structure of YBBD in complex with pugnac [Bacillus subtilis],3NVD_B Structure of YBBD in complex with pugnac [Bacillus subtilis]
4GYJ_A	4.07e-37	40	380	27	400	Crystalstructure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYJ_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYK_A Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168],4GYK_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B4SRK3	3.98e-39	65	340	1	279	Beta-hexosaminidase OS=Stenotrophomonas maltophilia (strain R551-3) OX=391008 GN=nagZ PE=3 SV=1
Q0AF74	7.39e-39	66	370	6	317	Beta-hexosaminidase OS=Nitrosomonas eutropha (strain DSM 101675 / C91 / Nm57) OX=335283 GN=nagZ PE=3 SV=1
P48823	1.33e-38	73	377	49	380	Beta-hexosaminidase A OS=Pseudoalteromonas piscicida OX=43662 GN=cht60 PE=1 SV=1
B2FPW9	1.51e-38	65	340	1	279	Beta-hexosaminidase OS=Stenotrophomonas maltophilia (strain K279a) OX=522373 GN=nagZ PE=3 SV=1
A6VKU4	3.81e-37	66	352	4	293	Beta-hexosaminidase OS=Actinobacillus succinogenes (strain ATCC 55618 / DSM 22257 / CCUG 43843 / 130Z) OX=339671 GN=nagZ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000000	1.000031	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002640_01442.