CAZyme Information: MGYG000002641_00375

Basic Information

• Species: Faecalibacterium sp003449675
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; Faecalibacterium; Faecalibacterium sp003449675
• CAZyme ID: MGYG000002641_00375
• CAZy Family: GH23
• CAZyme Description: Membrane-bound lytic murein transglycosylase C

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
221	MGYG000002641_2|CGC1	25833.53	8.2096

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002641	2686912	MAG	China	Asia

• Gene Location: Start: 14981; End: 15646 Strand: -

Full Sequence      

MNEQNYEKAYDPIAARERRAAREKQRIRKQQRRRRMVRRLAALCLAVVLTVCVVPPLCNW
AEQFLYPRKYEQLVEKWATAYKLDPLLVYAFIRTESGFDPQATSSVDARGLMQMTEETFL
WMRSKIAPEEPLTFADLYNPDTAIRFGCYYLHLCMERYKGDVSTAAAAYHSGWGTVDQLL
QMEEHSADGETLQGFPYNQMHHYVNKITACYQTYQRLYAGQ

Enzyme Prediction     

No EC number prediction in MGYG000002641_00375.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	83	215	1.1e-28	0.8222222222222222

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd16896	LT_Slt70-like	2.66e-54	67	212	1	145	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd13401	Slt70-like	1.92e-35	65	217	1	152	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
cd00254	LT-like	6.54e-28	85	212	1	111	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
pfam01464	SLT	2.28e-24	76	176	3	99	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.
COG0741	MltE	7.08e-23	66	220	135	289	Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AXB28497.1	3.27e-130	1	221	1	221
AXA80758.1	1.16e-96	43	220	18	194
CBK98413.1	2.71e-95	43	220	18	194
ATL89088.1	7.43e-89	45	220	8	187
ATO98725.1	3.50e-87	45	220	8	187

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MPQ_A	6.13e-09	59	220	407	561	BulgecinA: The key to a broad-spectrum inhibitor that targets lytic transglycosylases [Neisseria meningitidis]
5O1J_A	6.15e-09	59	220	411	565	Lytictransglycosylase in action [Neisseria meningitidis MC58]
6FPN_B	6.17e-09	59	220	417	571	Lytictransglycosylase in action [Neisseria meningitidis MC58]
5O24_A	6.18e-09	59	220	421	575	Lytictransglycosylase in action [Neisseria meningitidis]
5O29_A	6.20e-09	59	220	427	581	Lytictransglycosylase in action [Neisseria meningitidis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O31608	1.75e-12	71	211	61	179	Putative murein lytic transglycosylase YjbJ OS=Bacillus subtilis (strain 168) OX=224308 GN=yjbJ PE=3 SV=1
O31976	4.18e-11	66	211	1418	1541	SPbeta prophage-derived uncharacterized transglycosylase YomI OS=Bacillus subtilis (strain 168) OX=224308 GN=yomI PE=3 SV=2
O64046	4.18e-11	66	211	1418	1541	Probable tape measure protein OS=Bacillus phage SPbeta OX=66797 GN=yomI PE=3 SV=1
A8GJ50	2.70e-08	68	216	189	357	Membrane-bound lytic murein transglycosylase C OS=Serratia proteamaculans (strain 568) OX=399741 GN=mltC PE=3 SV=1
B2K0V2	3.65e-08	68	216	189	357	Membrane-bound lytic murein transglycosylase C OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) OX=502801 GN=mltC PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.969411	0.024521	0.004835	0.000252	0.000134	0.000832

TMHMM  Annotations     

start	end
36	58