CAZyme Information: MGYG000002641_01013

Basic Information

• Species: Faecalibacterium sp003449675
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; Faecalibacterium; Faecalibacterium sp003449675
• CAZyme ID: MGYG000002641_01013
• CAZy Family: CE8
• CAZyme Description: Pectinesterase A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
321		34214.67	5.9656

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002641	2686912	MAG	China	Asia

• Gene Location: Start: 35020; End: 35985 Strand: -

Full Sequence      

MLTINVAPDGSGQFTTISEAVLAVPYDCPAVIRIAPGIYREKLVCEKKDITLAGAGMDAT
RLVWNDGGKLPHPDGRPTHTFRSYTAFFSGEKLRVEDMTIENDAGPGAKAGQAIAAYVDS
ARAAFSRVRLLGNQDTLFCAPLPEKEREKDGFLGPRVLAPRRASAQYYHACEIAGDIDFI
FGGADALFEHCTLRTVDNGLAHSWVTAPSGAAAGLGFVFWDCDFVSDCPAGSVYLGRPWR
PTGKTAVLDCRLGAHIAPEGFAGWNDRTDTALAGFAEAGSTGAGAGERPGWVQTLSVAEA
AALLRTARQKCRMETTERITG

Enzyme Prediction     

No EC number prediction in MGYG000002641_01013.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	4	303	4.3e-76	0.9652777777777778

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4677	PemB	7.88e-53	6	296	87	389	Pectin methylesterase and related acyl-CoA thioesterases [Carbohydrate transport and metabolism, Lipid transport and metabolism].
pfam01095	Pectinesterase	1.34e-50	6	300	4	286	Pectinesterase.
PLN02773	PLN02773	3.18e-47	4	304	7	291	pectinesterase
PLN02432	PLN02432	3.31e-39	2	304	11	281	putative pectinesterase
PLN02682	PLN02682	3.49e-38	2	300	69	352	pectinesterase family protein

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AXB27671.1	7.19e-234	1	320	1	320
CBL01447.1	7.19e-234	1	320	1	320
AXA81880.1	1.28e-180	1	315	1	315
CBK98674.1	8.59e-179	1	315	1	315
QIA44050.1	7.35e-177	1	312	1	312

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1XG2_A	1.08e-24	6	286	7	270	ChainA, Pectinesterase 1 [Solanum lycopersicum]
1GQ8_A	1.40e-22	6	285	11	273	Pectinmethylesterase from Carrot [Daucus carota]
3UW0_A	1.22e-21	4	242	35	272	Pectinmethylesterase from Yersinia enterocolitica [Yersinia enterocolitica subsp. enterocolitica 8081]
2NSP_A	1.35e-16	14	256	18	276	ChainA, Pectinesterase A [Dickeya dadantii 3937],2NSP_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NST_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NST_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT6_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT6_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT9_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT9_B Chain B, Pectinesterase A [Dickeya dadantii 3937]
1QJV_A	3.61e-13	14	256	18	276	ChainA, PECTIN METHYLESTERASE [Dickeya chrysanthemi],1QJV_B Chain B, PECTIN METHYLESTERASE [Dickeya chrysanthemi]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9LVQ0	2.01e-35	4	300	7	287	Pectinesterase 31 OS=Arabidopsis thaliana OX=3702 GN=PME31 PE=1 SV=1
Q43062	5.94e-28	6	265	211	454	Pectinesterase/pectinesterase inhibitor PPE8B OS=Prunus persica OX=3760 PE=2 SV=1
Q8VYZ3	1.84e-27	12	300	94	366	Probable pectinesterase 53 OS=Arabidopsis thaliana OX=3702 GN=PME53 PE=2 SV=1
Q9LXK7	2.59e-26	6	265	217	459	Probable pectinesterase/pectinesterase inhibitor 32 OS=Arabidopsis thaliana OX=3702 GN=PME32 PE=2 SV=1
Q8GXA1	4.27e-26	6	315	260	555	Probable pectinesterase/pectinesterase inhibitor 23 OS=Arabidopsis thaliana OX=3702 GN=PME23 PE=2 SV=3

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000071	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002641_01013.